Recombinant Human Inhibin beta E chain (INHBE)

In Stock
Code CSB-EP011722HUb0
Abbreviation Recombinant Human INHBE protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
(Activin beta-E chain)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
237-350aa
Target Protein Sequence
TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene fragment encoding the 237-350aa of human INHBE protein is expressed with an INHBE protein 6xHis tag gene in an E. coli system. A high-expression vector acting as a carrier for the expressed gene is introduced into E. coli cells for protein expression. The expressed protein is the recombinant INHBE protein, which is isolated and purified using Ni-NTA affinity chromatography from the cell lysate. The recombinant INHBE protein is analyzed by SDS-PAGE, confirming a purity greater than 90%.

The human inhibin beta E chain, encoded by the INHBE gene, is a member of the inhibin/activin family, which is part of the larger TGF-β superfamily. Inhibins, including inhibin beta E, are produced by the gonads and play critical roles in the regulation of follicle-stimulating hormone (FSH) secretion from the pituitary gland, thereby influencing reproductive processes [1][2].

Inhibin beta E is unique among the inhibin subunits due to its specific expression patterns and potential roles in various physiological and pathological contexts. It has been implicated in the regulation of ovarian function and has been studied in the context of ovarian diseases and cancers. Inhibin beta E can form heterodimers with the inhibin alpha subunit, contributing to the overall biological activity of inhibins [3][4]. Additionally, it is involved in signaling pathways that regulate cell growth and differentiation, particularly in the context of reproductive tissues [5].

Recent studies have highlighted the differential expression of inhibin beta E in various cancers, suggesting its potential as a biomarker for malignancies. Alterations in the expression of inhibin beta E have been observed in cervical cancer, indicating its involvement in tumor biology [3].

References:
[1] M. M’Baye, G. Hua, H. Khan, & L. Yang, Rnai-mediated knockdown of <i>inhbb</i> increases apoptosis and inhibits steroidogenesis in mouse granulosa cells, Journal of Reproduction and Development, vol. 61, no. 5, p. 391-397, 2015. https://doi.org/10.1262/jrd.2014-158
[2] I. Mylonas, U. Jeschke, I. Wiest, A. Hoeing, J. Vogl, N. Shabani, et al. Inhibin/activin subunits alpha, beta-a and beta-b are differentially expressed in normal human endometrium throughout the menstrual cycle, Histochemistry and Cell Biology, vol. 122, no. 5, p. 461-471, 2000. https://doi.org/10.1007/s00418-004-0709-6
[3] F. Bergauer, A. Brüning, N. Shabani, T. Blankenstein, J. Jückstöck, D. Dian, et al. Inhibin/activin-betae subunit in normal and malignant human cervical tissue and cervical cancer cell lines, Journal of Molecular Histology, vol. 40, no. 5-6, p. 353-359, 2009. https://doi.org/10.1007/s10735-009-9246-x
[4] M. Lei, L. Cai, H. Li, Z. Chen, & Z. Shi, Transcriptome sequencing analysis of porcine granulosa cells treated with an anti-inhibin antibody, Reproductive Biology, vol. 17, no. 1, p. 79-88, 2017. https://doi.org/10.1016/j.repbio.2017.01.002
[5] A. Kita, A. Kasamatsu, D. Nakashima, Y. Endo‐Sakamoto, S. Ishida, T. Shimizu, et al. Activin b regulates adhesion, invasiveness, and migratory activities in oral cancer: a potential biomarker for metastasis, Journal of Cancer, vol. 8, no. 11, p. 2033-2041, 2017. https://doi.org/10.7150/jca.18714

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Gene References into Functions
  1. INHBE functions as a possible hepatokine to alter the whole-body metabolic status under obese insulin-resistant condition PMID: 29596463
  2. Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist. PMID: 25062451
  3. The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line. PMID: 23580013
  4. differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation. PMID: 21092084
  5. Expression of the inhibin betaC and betaE subunits was demonstrated at the protein level and at the transcriptional level in normal human endometrial tissue and in the Ishikawa human endometrial carcinoma cell line. PMID: 20012305
  6. An immunolabelling of the inhibin-betaE subunit in normal and malignant cervical tissue, as well as cervical cancer cells, is demonstrated. PMID: 20033758
  7. cDNA cloning from a liver cDNA library, deduction of amino acid sequence, binding to follistatin, and analysis of the transcript in human liver PMID: 12242034
  8. activin E has a role in regulating the proliferation of pancreatic exocrine cells PMID: 16426570

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Database Links

HGNC: 24029

OMIM: 612031

KEGG: hsa:83729

STRING: 9606.ENSP00000266646

UniGene: Hs.632713

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*