Recombinant Human Interferon alpha-21(IFNA21)

Code CSB-YP011039HU
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. P01568
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interferon alpha-F ;LeIF F
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Research Area Immunology
Source Yeast
Gene Names IFNA21
Protein Names Recommended name: Interferon alpha-21 Short name= IFN-alpha-21 Alternative name(s): Interferon alpha-F Short name= LeIF F
Expression Region 24-189aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 6xHis-tagged
Mol. Weight 21.3kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes
Subcellular location Secreted
Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Necroptosis
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway

Related Products

IFNA21 Antibodies

IFNA21 Antibodies for Homo sapiens (Human)

IFNA21 Proteins

IFNA21 Proteins for Homo sapiens (Human)

IFNA21 ELISA Kit

IFNA21 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.