Recombinant Human Interferon alpha-6(IFNA6)

In Stock

Code CSB-EP011042HU
Product Type Recombinant Protein
Size US$298
Uniprot No. P05013
Lead Time 3-7 business days
Relevance Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011042HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IFNA6.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011042HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IFNA6.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Research Area Cancer
Source E.coli
Gene Names IFNA6
Protein Names Interferon alpha-54 Interferon alpha-K Short name: LeIF K
Expression Region 21-189aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 25.1 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Database Links

HGNC: 5427

OMIM: 147566

KEGG: hsa:3443

STRING: 9606.ENSP00000369558

UniGene: Hs.533470

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Necroptosis
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway

Related Products

IFNA6 Proteins

IFNA6 Proteins for Homo sapiens (Human)

IFNA6 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.