Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial

In Stock
Code CSB-MP614402HU
Abbreviation Recombinant Human IL15RA protein, partial
MSDS
Size $124
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of IL15RA was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Target Names
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
31-205aa
Target Protein Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.3 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. In neutrophils, binds and activates kinase SYK in response to IL15 stimulation. In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner. Expression of different isoforms may alter or interfere with signal transduction.; Does not bind IL15.; Does not bind IL15.; Does not bind IL15.; Does not bind IL15.
Gene References into Functions
  1. Men with the IL-15Ralpha 1775AA genotype spent more time in light intensity physical activity (39.4 +/- 2.4 hr/week) than men with the CC genotype (28.6 +/- 2.3 hr/week, (p = .009). PMID: 29624921
  2. this study describes variants of splicing of IL-15Ra expressed in intestinal epithelial cells, and identifies those variants with the ability of binding IL-15 and following the secretory pathway, as well as determines if any of these variants are regulated by methylation of DNA PMID: 27794069
  3. significant association of rs2228059 with ossification of the posterior longitudinal ligament of the spine in Chinese Han population PMID: 25387549
  4. Report Il15Ralpha levels in synovial fluid from rheumatoid arthritis patients. PMID: 25879761
  5. NK cell activation in human hantavirus infection explained by virus-induced IL-15/IL15Ralpha expression PMID: 25412359
  6. Coexpression of IL15RA and IL15 was also sufficient to activate peripheral blood mononuclear cells. PMID: 24980552
  7. our study provides strong evidence that the functional IL-15RA rs2228059 A>C polymorphism may contribute to the risk of ESCC. PMID: 24464181
  8. We show that a gene transfer approach using recombinant adenovirus to express IL-15 and IL-15Ralpha in murine TRAMP-C2 prostate or TS/A breast tumors induced antitumor immune responses PMID: 24572789
  9. This present study demonstrated that IL15RA rs2228059 A > C polymorphism might modify Gastric cardiac adenocarcinoma susceptibility PMID: 24696261
  10. The proportion of IL-15Ralpha expression on total leukocytes was much lower for all rheumatic diseases, including Behcet disease, than in healthy controls PMID: 23417200
  11. Single nucleotide polymorphism in IL15RA gene is associated with ER-positive breast cancers only in American women of African ancestry. PMID: 23996684
  12. lower frequencies of IL-15RA-positive T cells in Behcet's disease PMID: 23618691
  13. Epidermal IL-15Ralpha acts as an endogenous antagonist of psoriasiform inflammation in mouse and man. PMID: 24019554
  14. The inflammatory bowel diseases patients have an increased expression of IL-15Ralpha mRNA in the mucosa; expression is localized in B cells, suggesting that IL-15 regulates B-cell functions during bowel inflammation. PMID: 23039249
  15. The expression of IL-15Ralpha on CD8 T cells is required for uncontrolled aggressive lymphoproliferation; none of the IL-15Ralpha(-/-)-IL-15 mice that we followed for more than 2 years developed the fatal disease despite controlled expansion of CD8 T cells PMID: 21304101
  16. IL-15 is produced and secreted only as a heterodimer with IL-15Ralpha. PMID: 22496150
  17. High serum IL-15R alpha is associated with T-cell large granular lymphocyte leukemia. PMID: 22049515
  18. These results suggest that IL15RA polymorphism may be associated with the susceptibility of ossification of the posterior longitudinal ligament in Korean population. PMID: 21689944
  19. Different levels of IL-15 trans-presentation are required for different natural killer (NK) cell developmental events to reach full maturation status PMID: 21715685
  20. broad expression pattern of functional IL-15RA splicing forms and suggests a regulatory role of DNA methylation in IL-15RA transcript Var1 expression in mononuclear cells PMID: 21097393
  21. mRNA for IL-15 receptor alpha was constitutively expressed in all tested human fetal brain structures, indicating a role in their development and physiology PMID: 12114302
  22. interleukin-15alpha receptor binds to IL-15 at specific binding sites, one in the B helix and the other in the C helix PMID: 15039446
  23. Soluble IL-15R alpha arises from proteolytic shedding of the membrane-anchored receptor. It is an inhibitor of IL-15 binding to the membrane receptor & of IL-15-induced cell proliferation. IL-15R alpha shedding may have major immunoregulatory functions. PMID: 15265897
  24. IL-15 is an important mediator of muscle mass response to resistance exercise training in humans and that genetic variation in IL15RA accounts for a significant proportion of the variability in this response. PMID: 15531573
  25. Study of three-dimensional structure of IL-15 receptor (IL-15R) alpha chain has led to a model of the IL-15.IL-15R alpha complex that reveals involvement of a large network of ionic interactions not observed in other cytokine/cytokine receptor complexes. PMID: 16377614
  26. Results show that the biological activity of soluble IL-15 is much improved after interaction with recombinant soluble IL-15Ralpha. PMID: 16757567
  27. Data show that NK cell survival mediated through the regulatory synapse with human dendritic cells requires IL-15Ralpha. PMID: 17948125
  28. sIL-15Ralpha has a protumor role in cancer PMID: 18483276
  29. genetic variability of the IL-15 receptor has an important role in body fat composition. PMID: 19309557
  30. IL-15 receptor alpha facilitates the stability and secretion of the IL-15 short signal peptide, a soluble and bioactive isoform. PMID: 19696432

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Cell surface. Note=Mainly found associated with the nuclear membrane.; [Isoform 5]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Isoform 6]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Isoform 7]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Isoform 8]: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass type I membrane protein. Membrane; Single-pass type I membrane protein. Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane.; [Soluble interleukin-15 receptor subunit alpha]: Secreted, extracellular space.
Tissue Specificity
Expressed in neutrophils (at protein level). Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all br
Database Links

HGNC: 5978

OMIM: 601070

KEGG: hsa:3601

STRING: 9606.ENSP00000369312

UniGene: Hs.445124

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*