Recombinant Human Interleukin-15(IL15)

In Stock
Code CSB-RP066374h
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P40933
Lead Time 3-7 business days
Relevance Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Research Area Metabolism
Source E.coli
Gene Names IL15
Expression Region 49-162aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Subcellular Location Isoform IL15-S48AA: Secreted, SUBCELLULAR LOCATION: Isoform IL15-S21AA: Cytoplasm, Nucleus
Protein Families IL-15/IL-21 family
Tissue Specificity Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
Database Links

HGNC: 5977

OMIM: 600554

KEGG: hsa:3600

STRING: 9606.ENSP00000296545

UniGene: Hs.168132

Pathway Jak-STAT signaling pathway
TNF signaling pathway

Related Products

IL15 Antibodies

IL15 Antibodies for Homo sapiens (Human)

IL15 Proteins

IL15 Proteins for Homo sapiens (Human)

IL15 ELISA Kit

IL15 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.