Recombinant Human Interleukin-15 (IL15) (Active)

In Stock
Code CSB-AP004391HU
Abbreviation Recombinant Human IL15 protein (Active)
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is 40-200pg/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
IL 15; IL-15; IL15; IL15_HUMAN; Interleukin 15; Interleukin-15; Interleukin15; MGC9721
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
49-162aa
Complete Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Mol. Weight
12.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Interleukin-15 (IL15) is expressed in E. coli and represents the full length of the mature protein, spanning amino acids 49-162. This tag-free protein is produced with a purity exceeding 95%, as verified by SDS-PAGE analysis. It demonstrates biological activity, with an effective dose (ED50) in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells ranging from 40 to 200 pg/ml. The endotoxin level is maintained below 1.0 EU/µg, as determined by the LAL method.

Interleukin-15 (IL15) appears to be a central player in immune response regulation. This cytokine is particularly important for the proliferation and survival of natural killer (NK) cells and CD8+ T cells, which may contribute significantly to adaptive immunity. Researchers studying immune cell function, cancer immunotherapy, and vaccine development often turn to IL15 for insights into potential therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. T Cell Proliferation and Activation Studies

This recombinant IL-15 is confirmed to be highly bioactive (ED₅₀ 40-200 pg/ml in CTLL-2 cells) and suitable for T cell studies. However, as it is expressed in E. coli, it lacks glycosylation, which may affect protein stability or in vivo half-life compared to native IL-15. Researchers should validate its activity in human primary T cells and NK cells to ensure cross-reactivity, as CTLL-2 is a mouse cell line and may not fully represent human immune responses. The high purity and low endotoxin support reliable results in sensitive assays.

2. Natural Killer Cell Functional Assays

The protein is appropriate for NK cell studies, but its activity should be validated in primary human NK cells, as the ED₅₀ was determined in mouse CTLL-2 cells (a T cell line), which may not directly translate to NK cell biology. The E. coli expression produces non-glycosylated IL-15, which could influence NK cell activation or survival kinetics. Dose-response curves should be established specifically for human NK cells to ensure physiological relevance.

3. Cytokine Signaling Pathway Analysis

The biologically active IL-15 is suitable for signaling studies (e.g., JAK-STAT pathway activation). The tag-free design avoids tag-related artifacts. However, the non-glycosylated form may alter signaling dynamics (e.g., receptor binding affinity or signal duration) compared to glycosylated IL-15. Researchers should confirm phosphorylation events and downstream responses in human immune cells to ensure native-like signaling.

4. Antibody Development and Validation

This IL-15 serves as a good antigen for antibody development due to its full-length mature sequence, but antibodies generated against this E. coli-expressed, non-glycosylated protein may not recognize glycosylated epitopes on native IL-15. Comprehensive validation should include testing against mammalian-expressed or natural IL-15 from biological sources to ensure broad epitope coverage and physiological relevance. The bioactivity supports functional neutralization assays.

5. Immunotherapy Mechanism Studies

The protein can be used in preclinical immunotherapy research, but the E. coli expression and lack of glycosylation may limit in vivo applications due to potential immunogenicity or rapid clearance. For in vitro co-culture studies, it is suitable, but for animal models, consider using mammalian-expressed IL-15 to avoid species-specific immune responses. The low endotoxin is beneficial for complex assays, but in vivo efficacy should be validated with glycosylated forms.

Final Recommendation & Action Plan

This recombinant human IL-15 expressed in E. coli is a highly potent tool for in vitro studies, as evidenced by its low ED₅₀ in CTLL-2 cells, but researchers must account for its non-glycosylated state and prokaryotic expression system. For immediate use, employ it at picogram-level concentrations (40-200 pg/ml) based on the ED₅₀, but validate dose-response relationships in human primary T cells and NK cells to ensure cross-species reactivity and physiological relevance. When studying signaling pathways, the tag-free design is advantageous, but comparing key kinetics with mammalian-expressed IL-15 to address potential glycosylation-related differences. For antibody development, use this protein for immunization, but rigorously validate antibodies against glycosylated IL-15 to ensure recognition of native epitopes. In immunotherapy research, restrict initial studies to in vitro models and transition to mammalian-expressed IL-15 for in vivo work to avoid immunogenicity. Always include controls for non-specific effects (e.g., endotoxin, vehicle) and prioritize validation in human cell systems to bridge the gap between mouse CTLL-2 data and human immunology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL15 requires interaction of IL15 with components of the IL2 receptor, including IL2RB and probably IL2RG but not IL2RA. In neutrophils, stimulates phagocytosis probably by signaling through the IL15 receptor, composed of the subunits IL15RA, IL2RB and IL2RG, which results in kinase SYK activation.
Gene References into Functions
  1. High IL15 expression is associated with follicles with immature oocytes. PMID: 29619608
  2. IL-15 plays a pivotal role in creating a self-renewing, persistent HIV reservoir by facilitating infection of CD4(+) T cells with stem cell-like properties. PMID: 30257946
  3. The genetic variations in IL15 affects the risk of developing of childhood acute lymphoblastic leukemia and are associated with hyperdiploidy in Latvian population. PMID: 29528261
  4. circulating IL-15 and IL-15Ralpha concentrations are reduced in lean and obese physically active people PMID: 28940555
  5. IL-15/IL-15Ralpha signaling pathway is activated in skeletal muscle in response to a session of resistance exercise. PMID: 28449327
  6. Recipient IL-15 rs10519613 polymorphism was associated with hepatocellular carcinoma recurrence after liver transplantation. PMID: 29162948
  7. This review provides significant characterization of specific systemic, cellular and molecular alterations caused by IL-15 superagonist treatment as compared to native IL-15 and compares their anti-tumor effectiveness in multiple preclinical studies [Review] PMID: 28888485
  8. iNKT cell development requires IL-15, and study found that sgammac interfered with IL-15 signaling to suppress iNKT cell generation in the thymus. Thus, sgammac represents a new mechanism to control cytokine availability during T cell development that constrains mature T cell production and specifically iNKT cell generation in the thymus. PMID: 27833166
  9. The rs10833 polymorphism could be involved in regulating IL-15 production in subclinical atherosclerosis. PMID: 28923712
  10. RFC, IL15 and VDR germline variants are associated with minimal residual disease in pediatric B-cell precursor ALL PMID: 27427275
  11. IL-15 and IL-15Ralpha genes in samples from the Spanish Consortium for Genetics of Celiac Disease (CEGEC) collection, identifying two regulatory single-nucleotide polymorphisms (SNP) that might be associated with celiac disease PMID: 28738233
  12. associated with increased loss of fat mass and body weight [review] PMID: 28752527
  13. These data support the combinatorial approach of in situ suppression of the PD-L inhibitory checkpoints with DC-mediated IL15 transpresentation to promote antigen-specific T-cell responses and, ultimately, contribute to graft-versus-tumor immunity PMID: 28637876
  14. These data suggest that TLR2 activation is involved in the induction of IL-15 production by primary Sjogren's syndrome salivary gland epithelial cells and promotes inflammation through NF-kappaB activation. PMID: 27260411
  15. this review will focus on IL-15 biology in NK cells and proposes the development novel therapies aimed at this pathway in humans PMID: 27835762
  16. IL-15 levels were found to be elevated in depressed patients with asthma. PMID: 26874516
  17. this paper show that IL-15 boosts the function and migration of human terminally differentiated CD8+ T cells by inducing a unique gene signature PMID: 26857736
  18. inhibits the Ca(2+)-induced differentiation of keratinocytes, mainly via the attenuation of Ca(2+)-stimulated PI3K-AKT signalling PMID: 26914593
  19. The 161533 TriKE induced superior NK cell cytotoxicity, degranulation, and cytokine production against CD33(+) HL-60 targets and increased NK survival and proliferation. PMID: 26847056
  20. In this article, we review the functions, expression, and regulation of IL-15 for designing an improved IL-15-based therapy targeting the IL-15 signaling pathway. PMID: 27325459
  21. n this study, authors compared the concentrations of IL-15 and IL-7 in the plasma of MDS patients (n = 20) compared with that in the plasma of healthy controls (n = 20). Results indicated that exposure to high levels of IL-15 may be involved in the T cell phenotype conversion observed in MDS. PMID: 27036031
  22. The presence of IL15 rs10833 AA genotype in HIV-/HCV-co-infected patients was associated with advanced liver fibrosis, inflammation-related biomarkers and increased rates of sustained virological response to pegIFN-alpha/RBV therapy. PMID: 26836972
  23. High IL15 expression is associated with endometriosis. PMID: 27190213
  24. IL-15 drives bystander activation of CD8+ T cells, which predicts disease progression in untreated HIV-1-infected patients and suggests that elevated IL-15 may also drive CD8+ T cell expansion that is linked to increased morbidity and mortality in treated patients PMID: 27322062
  25. Sustained virologic response was significantly associated with IL15 rs10833 in chronic hepatitis C patients, treated with pegylated interferon-alpha and ribavirin. PMID: 28827115
  26. IL-15 mRNA and protein levels significantly increased in rhHBcAg stimulation group compared with non-stimulated group. PMID: 28274303
  27. this work provides evidence that the sushi-IL-15Ralpha/IL-15 fusion protein RLI enhances antitumor activity of anti-PD-1 treatment and is a promising approach to stimulate host immunity PMID: 27217584
  28. This analysis revealed highly connected functional interaction networks with two candidate genes, IL15 and SEC14L5 highly enriched in networks. Overall, from these results, we concluded that these genes can be recommended as some of the potential targets for Post-Traumatic Stress Disorder. PMID: 27997584
  29. These data support a potential role for IL-15 in the pathogenesis of HIV-associated immune activation. PMID: 27880829
  30. 15Ralpha/15 complexes represent a potent adjuvant for augmenting the efficacy of adoptive immunotherapy. Such cell-bound or soluble 15Ralpha/15 complexes could be developed for use in combination immunotherapy approaches. PMID: 27227483
  31. Cutaneous T-cell lymphoma (CTCL) pathogenesis remains unknown, and there are no curative therapies. Our findings not only demonstrate a critical role for IL15-mediated inflammation in cutaneous T-cell lymphomagenesis, but also uncover a new oncogenic regulatory loop in CTCL involving IL15, HDAC1, HDAC6, and miR-21 that shows differential sensitivity to isotype-specific HDAC inhibitors PMID: 27422033
  32. we provide the first direct evidence that IL-15 is expressed both at the mRNA and protein level in human salivary gland epithelial cells and it is clear that salivary glands from primary Sjogren's syndrome patients showed an intensified epithelial expression of IL-15 PMID: 27567226
  33. Data show a greater expression of interleukin 15 (IL-15) mRNA in healing wounds compared with non-healing wounds. PMID: 27460304
  34. Our study indicates that the IL15 +96522A/C polymorphism correlates with the severity of Hashimoto's disease (HD), most likely by increasing Th17 cells. PMID: 28164472
  35. this study shows that IL-15 induces cytokine-induced killer cells with a potent cytotoxic activity mostly against tumor cells from epithelial solid malignancies via NKG2D-mediated mechanism. PMID: 27615504
  36. IL-15 is able to significantly regulate the inflammatory infiltration of macrophages in polymyositis patients through affecting the NF-kB pathway and MMP-9 expression levels. PMID: 27374114
  37. IL-15 mRNA expression was significantly higher in patients with moderately severe viral bronchiolitis compared to controls and patients with severe disease. Serum IL15 correlated with disease severity. PMID: 26541527
  38. These data underline the potential of "free" IL15 in the absence of Ralpha-complex as a powerful and specific immuno-modulator, which may be beneficial where selective immune-activation is desired. PMID: 26822794
  39. Culturing NK cells under hypoxia compared with ambient air (normoxia) and IL-15 priming synergistically augmented glycolytic gene expression without major changes in glycolytic flux and glucose consumption. PMID: 27129235
  40. Findings suggest for co-targeting shedding-derived soluble MIC (sMIC) to enhance the therapeutic efficacy of ALT-803 or other interleukin 15 (IL-15) agonists. PMID: 26625316
  41. Report improved antitumoral NK-cell activity in DC-based vaccine strategies through the use of IL-15/IL-15Ralpha mRNA-engineered designer DC. PMID: 26675759
  42. The novel mechanism of IL-15 transfer to the surface of antigen-processing DCs may explain the enhanced potency of IL-15:IL-15Ralpha-coated nanoparticles for antigen delivery. PMID: 26719339
  43. Virtual memory T cells develop and mediate bystander protective immunity in an IL-15-dependent manner. PMID: 27097762
  44. results demonstrated the relative functional deficiencies of alpha-GalCer induced UCB iNKT cells, which can be ameliorated by IL-15 PMID: 26481260
  45. Protein, mRNA, and serum expression levels of MMP-7 and IL-15 in patients with osteoarthritis were all significantly increased in osteoarthritis patients compared with the control group. PMID: 26464654
  46. Downregulation of STAT3 phosphorylation enhances tumoricidal effect of IL-15-activated dendritic cell against doxorubicin-resistant lymphoma and leukemia via TNF-alpha. PMID: 26255115
  47. Exercise-stimulated interleukin-15 is controlled by AMPK and regulates skin metabolism and aging. PMID: 25902870
  48. Studeis indicate that expression of interleukin-15 (IL-15) in tissues promotes T helper 1 cell-mediated immunity. PMID: 26567920
  49. These findings demonstrate a novel mechanism to attenuate IL-15-dependent NK cell proliferation and suggest that inhibitory NK cell receptors contribute to NK cell homeostasis. PMID: 26453750
  50. IL15 was expressed primarily in the suprabulb of the hair follicle. PMID: 26479922

Show More

Hide All

Subcellular Location
[Isoform IL15-S48AA]: Secreted.; [Isoform IL15-S21AA]: Cytoplasm. Nucleus. Note=IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.
Protein Families
IL-15/IL-21 family
Tissue Specificity
Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
Database Links

HGNC: 5977

OMIM: 600554

KEGG: hsa:3600

STRING: 9606.ENSP00000296545

UniGene: Hs.168132

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*