Recombinant Human Interleukin-15(IL15)

In Stock
Code CSB-AP004391HU
Product Type Interleukin
Size US$195
Uniprot No. P40933
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Alias Interleukin-15; IL-15; IL15
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 0.5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Research Area Immunology
Source E.coli
Gene Names IL15
Expression Region 49-162aa
Tag Info Tag-Free
Mol. Weight 12.5 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Subcellular Location Isoform IL15-S48AA: Secreted, SUBCELLULAR LOCATION: Isoform IL15-S21AA: Cytoplasm, Nucleus
Protein Families IL-15/IL-21 family
Tissue Specificity Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
Database Links

HGNC: 5977

OMIM: 600554

KEGG: hsa:3600

STRING: 9606.ENSP00000296545

UniGene: Hs.168132

Pathway Jak-STAT signaling pathway
TNF signaling pathway

Related Products

IL15 Antibodies

IL15 Antibodies for Homo sapiens (Human)

IL15 Proteins

IL15 Proteins for Homo sapiens (Human)

IL15 ELISA Kit

IL15 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.