Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial

In Stock
Code CSB-EP740921HU
Abbreviation Recombinant Human IL20RB protein, partial
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
DIRS1 ; Fibronectin type III domain containing 6; FNDC6 ; I20RB_HUMAN; IL 20R beta ; IL 20R2; IL-20 receptor subunit beta; IL-20R-beta; IL-20R2; IL-20RB; IL20RB; Interleukin 20 receptor beta; Interleukin 20 receptor beta chain precursor ; Interleukin 20 receptor II; Interleukin-20 receptor subunit beta; MGC34923
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-233aa
Target Protein Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The first step in producing the recombinant Human IL20RB protein is to construct a plasmid that encodes the Human IL20RB protein (30-233aa). The next is to transform this plasmid into e.coli cells, select positive e.coli cells, from which positive cells can be screened and cultured to express the protein. A N-terminal 6xHis tag is fused to the protein. The recombinant Human IL20RB protein is purified through affinity purification from the cell lysate. Its purity is greater than 85%, determined by the SDS-PAGE analysis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.
Gene References into Functions
  1. Trabecular meshwork cells express IL-20 receptors; Mutation of the T104 residue in IL-20R2 leads to a reduction in STAT3 phosphorylation as well as decreased matrix metalloproteinase activity PMID: 24455976
  2. The crystal structure of the IL-20/IL-20R1/IL-20R2 complex reveals how type I and II complexes discriminate cognate from noncognate ligands PMID: 22802649
  3. The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis and single nucleotide polymorphisms (SNPs) in the IL20RA and IL20RB genes in psoriasis patients were investigated. PMID: 18480827
Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type II cytokine receptor family
Tissue Specificity
Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin.
Database Links

HGNC: 6004

OMIM: 605621

KEGG: hsa:53833

STRING: 9606.ENSP00000328133

UniGene: Hs.61232

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*