Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

IL20RB

Uniprot No.

Q6UXL0

Research Area

Cancer

Alternative Names

DIRS1 ; Fibronectin type III domain containing 6; FNDC6 ; I20RB_HUMAN; IL 20R beta ; IL 20R2; IL-20 receptor subunit beta; IL-20R-beta; IL-20R2; IL-20RB; IL20RB; Interleukin 20 receptor beta; Interleukin 20 receptor beta chain precursor ; Interleukin 20 receptor II; Interleukin-20 receptor subunit beta; MGC34923

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

30-233aa

Target Protein Sequence

DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.9 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The first step in producing the recombinant Human IL20RB protein is to construct a plasmid that encodes the Human IL20RB protein (30-233aa). The next is to transform this plasmid into e.coli cells, select positive e.coli cells, from which positive cells can be screened and cultured to express the protein. A N-terminal 6xHis tag is fused to the protein. The recombinant Human IL20RB protein is purified through affinity purification from the cell lysate. Its purity is greater than 85%, determined by the SDS-PAGE analysis.

Target Background

Function

The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.

Gene References into Functions

Trabecular meshwork cells express IL-20 receptors; Mutation of the T104 residue in IL-20R2 leads to a reduction in STAT3 phosphorylation as well as decreased matrix metalloproteinase activity PMID: 24455976
The crystal structure of the IL-20/IL-20R1/IL-20R2 complex reveals how type I and II complexes discriminate cognate from noncognate ligands PMID: 22802649
The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis and single nucleotide polymorphisms (SNPs) in the IL20RA and IL20RB genes in psoriasis patients were investigated. PMID: 18480827

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Type II cytokine receptor family

Tissue Specificity

Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin.

Database Links

HGNC: 6004

OMIM: 605621

KEGG: hsa:53833

STRING: 9606.ENSP00000328133

UniGene: Hs.61232

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP740921HU
Abbreviation	Recombinant Human IL20RB protein, partial
MSDS	MSDS Datasheet
Size	US$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-20 receptor subunit beta (IL20RB), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage