Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
DIRS1 ; Fibronectin type III domain containing 6; FNDC6 ; I20RB_HUMAN; IL 20R beta ; IL 20R2; IL-20 receptor subunit beta; IL-20R-beta; IL-20R2; IL-20RB; IL20RB; Interleukin 20 receptor beta; Interleukin 20 receptor beta chain precursor ; Interleukin 20 receptor II; Interleukin-20 receptor subunit beta; MGC34923
Species
Homo sapiens (Human)
Expression Region
30-233aa
Target Protein Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The first step in producing the recombinant Human IL20RB protein is to construct a plasmid that encodes the Human IL20RB protein (30-233aa). The next is to transform this plasmid into e.coli cells, select positive e.coli cells, from which positive cells can be screened and cultured to express the protein. A N-terminal 6xHis tag is fused to the protein. The recombinant Human IL20RB protein is purified through affinity purification from the cell lysate. Its purity is greater than 85%, determined by the SDS-PAGE analysis.