Recombinant Human Interleukin-33 (IL33), partial

Code CSB-MP011656HU1
Abbreviation Recombinant Human IL33 protein, partial
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Interleukin-1 family member 11;Nuclear factor from high endothelial venules
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
109-270aa
Target Protein Sequence
HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.0 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury.; In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets. This form is rapidely lost upon angiogenic or proinflammatory activation.
Gene References into Functions
  1. IL-33 has a role in the pathogenesis of autoimmune hepatitis (AIH) and affects the expression of IL-4, IL-17A, and of hypergammaglobulinemia PMID: 30034292
  2. The serum levels of IL-33 and IL-31 were significantly up-regulated in both AR and allergic asthma patients compared with normal individuals. PMID: 30301503
  3. chromatin binding is a post-translational mechanism that regulates the releasability and ST2-mediated bioactivity of IL-33. PMID: 30108214
  4. Results indicate that the interaction between FLIL33 and IPO5 is localized to a specific segment of the FLIL33 protein, is not required for nuclear localization of FLIL33, and protects FLIL33 from proteasome-dependent degradation. PMID: 29127199
  5. Data suggest that targeting interleukin 33 (IL-33) may be an effective treatment for sepsis-induced immunosuppression. PMID: 28374774
  6. Oxidative stress is involved in the expression of IL-33 in airway epithelial cells via MAPK signal pathway and IL-33 expression is augmented during viral infection. PMID: 29587772
  7. IL-33 expression plays an important role in patients with chronic rhinosinusitis with nasal polyp. PMID: 29186722
  8. IL-33(high) cholangiocarcinomas may represent a unique, less aggressive carcinogenetic process of the large bile ducts PMID: 29675965
  9. Our data suggest that IL-33 produced by M2 macrophages might contribute to the pathogenesis of IgG4-RD via aberrant activation of Th2 immune responses. PMID: 28205524
  10. The GLDC/IL33 locus on chromosome 9p24.1 as associated with overall survival in patients with osteosarcoma. PMID: 29210060
  11. Serum and sputum IL-33 levels were higher in chronic obstructive pulmonary disease subjects with sputum eosinophilia compared to those with a normal eosinophil count. PMID: 29859068
  12. Studies suggest that IL-33 acts as a possible pathogenic role in allergic diseases mainly by instructing the activation of various ST2-expressing cells and the production of several immune factors. The mechanisms underlying IL-33-mediated inflammation have been immunologically analyzed. However, much remains regarding the accurate functions and underlying mechanisms of the IL-33-ST2 signaling pathway. [review] PMID: 29987222
  13. Higher IL-33 and lower s-ST2 receptor baseline serum levels were detected in Pru p 3--sensitized allergic patients (SAP). IL-33/s-ST2 ratio is increased in Pru p 3-SAP and more in patients who experienced severe systemic symptoms. PMID: 29774370
  14. Strong immune reaction to herpes virus infection may depend on strong IL-33 expression in the epidermis, while very weak immune reaction in samples from patients with verruca vulgaris may be due to low or no expression of IL-33 in the lesional epidermis. PMID: 29696682
  15. data indicate that during acute, resolving colitis, IL-33/ST2 plays a crucial role in gut mucosal healing by inducing epithelial-derived miR-320 that promotes epithelial repair/restitution and the resolution of inflammation. PMID: 30224451
  16. IL-33 facilitates proliferation of colorectal cancer dependent on COX2/PGE2. IL-33 functions via its receptor ST2 and upregulates COX2 expression through NF-kappaB signaling. Understanding the IL-33 signal transduction in colorectal cancer (CRC)cells provides potential therapeutic targets for clinical treatment PMID: 30119635
  17. Preincubation of LAD2 cells with the natural flavonoid methoxyluteolin (1-100 mM) inhibits (P < 0.0001) secretion and gene expression of IL-1beta, procaspase-1, and pro-IL-1beta. Mast cell secretion of IL-1beta in response to SP and IL-33 reveals targets for the development of antiinflammatory therapies. PMID: 30232261
  18. IL-33 could be suggested as a novel biomarker to distinguish different types of Salivary gland tumors PMID: 29991126
  19. IL-33 can regulate deposition of ECM and promote the process of pulmonary fibrosis by inducing the imbalance between MMP-9 and TIMP-1. PMID: 29417309
  20. these data demonstrate the expression of IL33 in oral lichen planus lesions PMID: 29633015
  21. The aim of this study was to explore the possible correlations of serum interleukins and soluble ST2 (sST2) protein with clinical features and inflammatory cytokines in rheumatoid arthritis (RA) patients. PMID: 29798971
  22. IL-33 may down-regulate CLDN1 expression through the ERK/STAT3 pathway in keratinocytes. PMID: 29534857
  23. IL-33 promotes Renal Cell Carcinoma cell proliferation and chemotherapy resistance via its receptor ST2 and the JNK signaling activation in tumor cells. PMID: 29763892
  24. Low IL-33 expression is associated with experimental autoimmune encephalomyelitis susceptibility only in females. PMID: 29378942
  25. High IL33 expression is associated with schistosome infection. PMID: 29554131
  26. Serum IL-33 levels were significantly higher in patients with Behcet's disease compared to the healthy controls. PMID: 28412856
  27. In the present review, we have discussed the cellular sources, modes of action and regulation of IL-17 and IL-33 in the context of hypersensitive diseases [Review] PMID: 29153708
  28. results suggest that IL-33 acts as a cytokine but not as a nuclear factor regulating gene expression in endothelial cells PMID: 27694941
  29. IL-33 increased IL-10 expression in MFCs via activating ERK 1/2 and STAT3, which subsequently promoted IL-10 transcription and thus contributed to the beneficial effects of IL-33 on MFCs. PMID: 29099095
  30. IL-33 contributes to hepatic granuloma pathology through induction of M2 macrophages during S. japonicum infection. PMID: 27445267
  31. Serum levels of ST2, IL-33 and BNP were independent risk factors for major adverse cardiovascular events in acute myocardial infarction after percutaneous coronary intervention. PMID: 28623858
  32. Recombinant human IL33 inhibited trophoblast invasion and adhesion, and decreased adhesion and invasionassociated molecules such as integrin alpha4beta1 and CD62L. PMID: 28765940
  33. TNF synthesis and secretion by mast cells is amplified by interactions of substance P and IL-33. PMID: 28461492
  34. Interleukin-33 signaling contributes to renal fibrosis following ischemia reperfusion PMID: 28668506
  35. Findings indicate that IL33 may be involved in the process of glioma cell invasion and migration by upregulating MMP2 and MMP9 via the ST2-NF-kappaB signaling pathway. PMID: 28849217
  36. IL-33 deficiency in mice does not lessen liver fibrosis during diet-induced steatohepatitis, in contrast to previous studies indicating a deleterious role of exogenous IL-33 in chronic liver injury and experimental NAFLD. PMID: 28611297
  37. The downregulation of epithelial IL-33 expression may potentially serve as a marker for disease remission in UC together with other biomarkers including mucosal TNF. PMID: 27748438
  38. Findings indicate that IL-10 act as a negative regulator of IL-33/ST2 signaling pathways in vivo. PMID: 28415811
  39. Study identify that IL-33 expression is reduced in many carcinomas upon their transition to the metastatic form of disease and, appears to be directly correlated with MHC-I and possibly co-regulated. These results suggest that the down-regulation of IL-33 takes place concomitantly with the transition from primary to metastatic tumors and represents an entirely new form of tumor immune-escape. PMID: 27619158
  40. The proinflammatory cytokine IL-33 induces differential tissue factor expression and activity in monocyte subsets, as well as the release of procoagulant microvesicless. In this manner, IL-33 may contribute to the formation of a prothrombotic state characteristic for cardiovascular disease. PMID: 28492698
  41. this review and meta-analysis showed that serum IL33 is a helpful biomarker for early diagnosis of childhood asthma PMID: 28410870
  42. IL-33 down-regulates the induction of hCAP-18/LL-37 production in human gingival epithelial cells. PMID: 28637951
  43. We found significantly higher serum IL-33 and soluble ST2 levels in patients with active adult-onset Still's disease. Results indicate that the IL-33/ST2 signaling pathway may play a role in the pathogenesis of the acute inflammation and skin manifestations associated with adult-onset Still's disease. PMID: 28365573
  44. IL-33 expression is associated with age and invasive depth of GC patients. PMID: 28000059
  45. serum levels elevated in both idiopathic granulomatous mastitis and breast cancer PMID: 27780363
  46. IL-33 induces IL-8 expression via JNK/c-Jun/AP-1 pathway in human vascular endothelial cells, and provides a new insight into the role of IL-33-induced IL-8 in the pathophysiology of atherosclerosis and vascular inflammation PMID: 29373608
  47. a relationship between glucose homeostasis and the IL-33/ST2 axis after transplantation PMID: 28013014
  48. The results of the present study indicate that ISTP may inhibit TARC/CCL17 production in human epidermal keratinocytes via the STAT1 signaling pathway and may be associated with the inhibition of IL33 production. PMID: 28447741
  49. Data suggest that interleukin-33 (IL-33) isoforms activate basophils and mast cells to drive type 2 inflammation in chronic stable asthma. PMID: 27432971
  50. Through induction of TF in vascular endothelial cells, IL-33 could enhance their thrombotic capacity and thereby might impact on thrombus formation in the setting of atherosclerosis. PMID: 27142573

Show More

Hide All

Subcellular Location
Nucleus. Chromosome. Cytoplasm. Cytoplasmic vesicle, secretory vesicle. Secreted.
Protein Families
IL-1 family
Tissue Specificity
Expressed at high level in high endothelial venules found in tonsils, Peyer patches and mesenteric lymph nodes. Almost undetectable in placenta.
Database Links

HGNC: 16028

OMIM: 608678

KEGG: hsa:90865

STRING: 9606.ENSP00000370842

UniGene: Hs.731660

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*