Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN)

In Stock
Code CSB-EP866201HU
Abbreviation Recombinant Human IL36RN protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
AI413231; Family of interleukin 1 delta; FIL1; FIL1 delta; FIL1(DELTA); FIL1D; Fil1delta; I36RA_HUMAN; IL 1 delta; IL 1 related protein 3; IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta); Il 1h3; IL 1HY1; IL 1L1; IL 1ra homolog; IL 1ra homolog, IL1F5 (Canonical product IL 1F5a); IL 1RP3; IL-1 delta; IL-1-related protein 3; IL-1F5; IL-1HY1; IL-1L1; IL-1ra homolog 1; IL-1RP3; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; IL36RN; Interleukin 1 delta; Interleukin 1 family member 5 (delta); Interleukin 1 family member 5; Interleukin 1 HY1; Interleukin 1 like protein 1; Interleukin 1 receptor antagonist homolog 1; Interleukin 36 receptor antagonist; Interleukin-1 delta; Interleukin-1 family member 5; Interleukin-1 HY1; Interleukin-1 receptor antagonist homolog 1; Interleukin-1-like protein 1; Interleukin-36 receptor antagonist protein; MGC29840; PSORP; RP23-176J12.6
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-155aa
Target Protein Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.0kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN) is produced in E. coli with an N-terminal 6xHis-SUMO tag. The full-length protein spans amino acids 1-155 and appears to achieve a purity level greater than 90% as confirmed by SDS-PAGE. While designed for research use, this product may provide reliable reproducibility in experimental applications.

IL36RN seems to act as a crucial regulator within the immune system, inhibiting the activity of interleukin-36 cytokines. When it binds to the interleukin-36 receptor, IL36RN likely modulates inflammatory responses. This makes it an important focus in studies related to immune regulation and inflammation-associated pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human IL36RN is a cytokine that requires precise folding and disulfide bond formation for its functional activity in binding to the IL-36 receptor and antagonizing IL-36 signaling. The E. coli expression system cannot perform the necessary eukaryotic post-translational modifications (particularly proper disulfide bonding) that are critical for IL36RN's native conformation. The large N-terminal SUMO tag (∼15 kDa) may sterically interfere with the protein's receptor-binding interfaces. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional receptor antagonism.

1. Antibody Development and Validation Studies

This recombinant IL36RN serves as an excellent immunogen for generating antibodies against linear epitopes of human IL36RN. The full-length sequence ensures comprehensive coverage of the epitope. The SUMO tag facilitates purification and immunization procedures. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded IL36RN found in biological systems.

2. ELISA Development and Optimization

This protein is well-suited as a standard for quantitative ELISA to detect immunoreactive IL36RN levels. The assay depends on antibody binding to linear epitopes, so the protein's folding state is less critical. The His-SUMO tag enables consistent immobilization for reliable standard curve generation.

3. Biochemical Characterization and Stability Studies

This is the essential first step to assess the protein's physical properties. Techniques like size-exclusion chromatography can determine oligomeric state, while circular dichroism can analyze secondary structure content and thermal stability. These studies provide critical quality control data but characterize this protein itself, not native IL36RN.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional version of this complex cytokine, limiting its applications to non-functional uses. The protein can be reliably used for Application 1 (Antibody Development) and Application 2 (as an ELISA standard). Application 3 (Biochemical Characterization) should be prioritized to understand the protein's physical properties. Cytokine-receptor interactions require a precise tertiary structure that this bacterially expressed IL36RN cannot provide. For functional IL36RN studies, the only valid approach is to use the protein expressed in a eukaryotic system (e.g., mammalian cells) that can provide proper disulfide bond formation and folding. 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Gene References into Functions
  1. systemic lupus erythematosus patients had significantly decreased serum IL-36Ra levels PMID: 29571080
  2. IL36RN may be the major disease-causing gene in generalized pustular psoriasis patients in Han population in Sichuan region of China. PMID: 30075588
  3. IL36RN mutations were strongly linked with early onset and hyponychial pustules, but not with therapeutic efficacy of acitretin or recurrence frequency. Early onset and hyponychial pustules may be specific to IL36RN mutation, however this alone is an insufficient biomarker for acitretin therapy. PMID: 29619998
  4. Using different blood leukocyte and skin resident cell preparations, and recombinant proteins, the authors have identified that neutrophil elastase, but not other neutrophil derived proteases, cleaves IL-36Ra into its highly active antagonistic form. PMID: 27101808
  5. A study on the association of IL36RN mutations that affect protein expression and function with phenotype in patients with generalized pustular psoriasis. PMID: 27220475
  6. The findings indicate that IL36RN mutations do not seem to contribute to the pathogenesis of common, nonpustular forms of psoriasis, but to the rarer pustular manifestations such as GPP, acrodermatitis continua suppurativa of Hallopeau and acute generalized exanthematous pustulosis. PMID: 27038307
  7. Some cases of geographic tongue are caused by IL36RN mutations, while those lacking mutations are associated with an imbalance in expression between IL-36Ra and IL-36gamma proteins in tongue tissue. PMID: 27900482
  8. Study data and the previous European study suggest that palmoplantar pustulosis is not associated with mutations of the IL36RN gene. PMID: 27542682
  9. Case Report: short-term infliximab for treatment of juvenile generalized pustular psoriasis with IL36RN mutation. PMID: 26627198
  10. The authors present a case of strikingly distinct phenotypes seen in two IL36RN mutation carriers from the same nonconsanguineous pedigree. This mutation it appears may influence the age of onset. PMID: 26147717
  11. The present study identified IL-36RN in various species and investigated the associations between IL-36RN and cancer prognosis. PMID: 26676204
  12. We identified a novel homozygous missense mutation in IL36RN in two siblings, and showed the molecular basis of the condition to be both distinct from psoriasis and distinct between the two families studied. PMID: 25688670
  13. generalized pustular psoriasis and early onset, ever generalized pustular psoriasis (more than two attacks), ever acrodermatitis continua of Hallopeau, inverse psoriasis, and a family history of pustular psoriasis were associated with IL36RN mutation. PMID: 26589685
  14. IL36RN was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples. PMID: 25897967
  15. IL36RN missense mutation was not associated with psoriasis. PMID: 25989471
  16. we report T123M and 115+6T>C mutations, both homozygous in nature, in two Japanese individuals with Zumbusch type of generalized pustular psoriasis. PMID: 25615897
  17. found 2 new variants and 4 known IL36RN variants in 29 generalized pustular psoriasis patients PMID: 25212972
  18. identified a novel IL36RN missense mutation, c.334G > A in exon 5, that caused p.E112K substitution and was located adjacent to a 113 amino acid residue in generalized pustular psoriasis PMID: 25468355
  19. The study found that IL36RN alleles define a generalized pustular psoriasis phenotype characterized by early onset, high risk of systemic inflammation, and low prevalence of psoriasis vulgaris. PMID: 25458002
  20. in a Chinese Daur family with generalized pustular psoriasis, identified a homozygous splice site mutation c.115+6T>C in intron 3 in both patients; other 4 family members and 7 healthy controls carried heterozygous c.115+6T>C mutations PMID: 24979538
  21. Individuals with IL36RN mutations are very susceptible to Generalized pustular psoriasis (GPP) or GPP-related generalized pustulosis induced by drugs. [review] PMID: 24656634
  22. We report two cases of impetigo herpetiformis with homozygous and heterozygous IL36RN mutations. PMID: 24717243
  23. IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin PMID: 24829417
  24. IL36RN variants are unlikely to confer significant disease risk for psoriasis vulgaris. PMID: 23792462
  25. Acrodermatitis is a clinical phenotype of DITRA: evidence a variant of pustular psoriasis... recessively inherited mutations in the IL36RN gene, which encodes interleukin-36 receptor antagonist... the cause of familial GPP, a condition termed DITRA PMID: 23428889
  26. The majority of generalized pustular psoriasis alone is caused by deficiency of the interleukin-36 receptor antagonist due to IL36RN mutations. PMID: 23698098
  27. The percentage of IL36RN mutations of pediatric generalized pustular psoriasis patients was much higher than that of adult onset patients. PMID: 23863864
  28. Our rate of 38.9% IL36RN mutations provides further evidence that generalized pustular psoriasis is heterogenous. PMID: 23648549
  29. IL36RN missense mutations may underlie some forms of acute generalized exanthematous pustulosis. PMID: 23358093
  30. Results indicate that IL36RN mutations are not associated with pustular psoriasis in Chinese populations. PMID: 22862555
  31. Rare pathogenic variants in IL36RN underlie a spectrum of psoriasis-associated pustular phenotypes. PMID: 23303454
  32. Data indicate that IL36RN mutations were identified in 2 of 14 Japanese generalized pustular psoriasis (GPP) patients. PMID: 22903787
  33. The mutation in the interleukin-36-receptor antagonist gene plays a role in generalised pustular psoriasis PMID: 22325761
  34. These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra. PMID: 22315422
  35. Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity PMID: 21965679
  36. Mutations in IL36RN/IL1F5 are associated with the severe episodic inflammatory skin disease known as generalized pustular psoriasis. PMID: 21839423
  37. Expression of IL-1F5 is increased in human plaque psoriasis skin and is overexpressed in the lesional psoriatic skin of transgenic mice. PMID: 21242515
  38. results suggest that polymorphisms within IL1RN and IL1L1 themselves or a gene in linkage disequilibrium with IL1RN and IL1L1 predispose to the more severe forms of alopecia areata PMID: 11841485
  39. The commnon variants in the IL-1 cluster gene are not associated with incidence of restenosis in patients after PTCA. PMID: 14644395
  40. IL-1beta-511T was associated with reflux esophagitis having hyperacidity. PMID: 16211343
  41. Data show that the gene expression for interleukin-8, IL-10, and IL-1Ra, but not IL-6, is increased in blood leukocytes taken from athletes following 2 hours of intensive cycling and is not influenced by carbohydrate compared with placebo ingestion. PMID: 16978071
  42. IL-1 delta, which shows striking homology to IL-1 receptor antagonist, specifically and potently inhibits NF-kappa B activation through the orphan IL-1 receptor-related protein 2. PMID: 11466363

Show More

Hide All

Involvement in disease
Psoriasis 14, pustular (PSORS14)
Subcellular Location
Cytoplasm. Secreted.
Protein Families
IL-1 family
Tissue Specificity
Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
Database Links

HGNC: 15561

OMIM: 605507

KEGG: hsa:26525

STRING: 9606.ENSP00000259212

UniGene: Hs.516301

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*