CD47|Proteinase K|EGFR|BCMA|PD-L1|CD276|ACE2|TMPRSS2|Exosome Isolation Kits
Code | CSB-AP004411HU |
Size |
US$3267Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to inhibit IL-36 alpha, IL-36 beta or IL-36 gamma -induced IL-8 secretion in A431 human epithelial carcinoma cells is less than 500 ng/ml in the presence of 10 ng/mL of recombinant human IL-36 beta. |
Target Names | IL36RN |
Uniprot No. | Q9UBH0 |
Research Area | Immunology |
Alternative Names | AI413231; Family of interleukin 1 delta; FIL1; FIL1 delta; FIL1(DELTA); FIL1D; Fil1delta; I36RA_HUMAN; IL 1 delta; IL 1 related protein 3; IL 1F5 (IL 1HY1, FIL1 delta, IL 1RP3, IL 1L1, IL 1 delta); Il 1h3; IL 1HY1; IL 1L1; IL 1ra homolog; IL 1ra homolog, IL1F5 (Canonical product IL 1F5a); IL 1RP3; IL-1 delta; IL-1-related protein 3; IL-1F5; IL-1HY1; IL-1L1; IL-1ra homolog 1; IL-1RP3; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; IL36RN; Interleukin 1 delta; Interleukin 1 family member 5 (delta); Interleukin 1 family member 5; Interleukin 1 HY1; Interleukin 1 like protein 1; Interleukin 1 receptor antagonist homolog 1; Interleukin 36 receptor antagonist; Interleukin-1 delta; Interleukin-1 family member 5; Interleukin-1 HY1; Interleukin-1 receptor antagonist homolog 1; Interleukin-1-like protein 1; Interleukin-36 receptor antagonist protein; MGC29840; PSORP; RP23-176J12.6 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-155aa |
Complete Sequence | MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Mol. Weight | 16.9 kDa |
Protein Length | Full Length |
Tag Info |
Tag-Free |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Function | Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR. |
Gene References into Functions |
|
Involvement in disease | Psoriasis 14, pustular (PSORS14) |
Subcellular Location | Secreted |
Protein Families | IL-1 family |
Tissue Specificity | Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. |
Database Links |
HGNC: 15561 OMIM: 605507 KEGG: hsa:26525 STRING: 9606.ENSP00000259212 UniGene: Hs.516301 |