Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN) (Active)

In Stock
Code CSB-AP004411HU
Product Type Interleukin
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q9UBH0
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Alias Interleukin-36 Receptor Antagonist Protein; FIL1 Delta; IL-1-Related Protein 3; IL-1RP3; Interleukin-1 HY1; IL-1HY1; Interleukin-1 Delta; IL-1 Delta; Interleukin-1 Family Member 5; IL-1F5; Interleukin-1 Receptor Antagonist Homolog 1; IL-1ra Homolog 1; Interleukin-1-Like Protein 1; IL-1L1; IL36RN; FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit IL-36 alpha, IL-36 beta or IL-36 gamma -induced IL-8 secretion in A431 human epithelial carcinoma cells is less than 500 ng/ml in the presence of 10 ng/mL of recombinant human IL-36 beta.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Research Area Immunology
Source E.coli
Gene Names IL36RN
Expression Region 1-155aa
Tag Info Tag-Free
Mol. Weight 16.9 kDa
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Involvement in disease Psoriasis 14, pustular (PSORS14)
Subcellular Location Secreted
Protein Families IL-1 family
Tissue Specificity Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
Database Links

HGNC: 15561

OMIM: 605507

KEGG: hsa:26525

STRING: 9606.ENSP00000259212

UniGene: Hs.516301

Related Products

IL36RN Antibodies

IL36RN Antibodies for Human

IL36RN Antibodies for Homo sapiens (Human)

IL36RN Proteins

IL36RN Proteins for Homo sapiens (Human)

IL36RN ELISA Kit

IL36RN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.