Recombinant Human Islet cell autoantigen 1(ICA1),partial

Code CSB-EP010947HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q05084
Relevance May play a role in neurotransmitter secretion.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 69 kDa islet cell autoantigen ;ICA69Islet cell autoantigen p69 ;ICAp69 ;p69
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK
Research Area Neuroscience
Source E.coli
Gene Names ICA1
Expression Region 1-268aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 35.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in neurotransmitter secretion.
Subcellular Location Cytoplasm, cytosol, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Peripheral membrane protein
Tissue Specificity Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
Database Links

HGNC: 5343

OMIM: 147625

KEGG: hsa:3382

STRING: 9606.ENSP00000379908

UniGene: Hs.487561

Related Products

ICA1 Antibodies

ICA1 Antibodies for Homo sapiens (Human)

ICA1 Antibodies for Human

ICA1 Proteins

ICA1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.