Recombinant Human Junctional adhesion molecule B (JAM2), partial

Code CSB-EP011936HU
Abbreviation Recombinant Human JAM2 protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
C21orf43; CD 322; CD322; CD322 antigen; JAM 2; JAM B; JAM IT/VE JAM; JAM; vascular endothelial; JAM-2; JAM-B; JAM2; JAM2_HUMAN; JAMB; Jcam2; Junction adhesion molecule 2; Junction adhesion molecule B; Junctional adhesion molecule 2; Junctional adhesion molecule B; PRO 245; PRO245; Vascular endothelial junction associated molecule; Vascular endothelial junction-associated molecule; VE JAM; VE-JAM; VEJAM
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
29-238aa
Target Protein Sequence
FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.5kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM3 to regulate different cellular processes. Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3. Plays a central role in leukocytes extravasation by facilitating not only transmigration but also tethering and rolling of leukocytes along the endothelium. Tethering and rolling of leukocytes are dependent on the binding by JAM2 of the integrin alpha-4/beta-1. Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation. Also functions as an inhibitory somatodendritic cue that prevents the myelination of non-axonal parts of neurons. During myogenesis, it is involved in myocyte fusion. May also play a role in angiogenesis.
Gene References into Functions
  1. this review briefly focuses on what is currently known about the structure, function, and mechanism of JAM-B, with particular emphasis on cancer. [review] PMID: 27121546
  2. JAM-2 may function as a putative tumour suppressor in the progression and metastasis of colorectal cancer PMID: 26782073
  3. This study showed thatJAM2 (rs2829841; intronic), associated with Alzheimer disease. PMID: 25649652
  4. Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells. PMID: 24357068
  5. These data brought new evidences for the role of JAM2 and JAM3 in progression of gastric adenocarcinoma PMID: 23277282
  6. role as an adhesive ligand for interacting with a variety of immune cell types PMID: 11823489
  7. interacts with alpha4beta1; Facilitation by JAM3 PMID: 12070135
  8. Results suggest a role for junctional adhesion molecule-2 (JAM-2) in facilitating transmigration in endothelial cells PMID: 12476045
  9. Examine JAM-2 expression in normal/inflammed lymphatic endothelium. PMID: 17822725
  10. Discovery as ligand for the integrin alpha4beta1 PMID: 12070135
  11. Cloning and discovery as adhesion receptor for T cells PMID: 10945976

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction. Cell junction, tight junction.
Protein Families
Immunoglobulin superfamily
Tissue Specificity
Highly expressed in heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules and also present on the endothelia of other vessels (at protein level). Also expressed in the brain in the caudate nuclei.
Database Links

HGNC: 14686

OMIM: 606870

KEGG: hsa:58494

STRING: 9606.ENSP00000420419

UniGene: Hs.517227

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*