Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human KLK2 at 2 μg/mL can bind Anti-KLK2 recombinant antibody (CSB-RA012453MA1HU). The EC50 is 0.6741-0.8245 ng/mL.
②Measured by its ability to cleave a flourogenic peptide substrate Pro-Phe-Arg-7-amido-4-methylcoumarin (PFR-AMC). The specific activity is >350 pmol/min/µg.

Target Names

KLK2

Uniprot No.

P20151

Alternative Names

Kallikrein-2; EC 3.4.21.35; Glandular kallikrein-1; hGK-1; Tissue kallikrein-2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-261aa

Target Protein Sequence

PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Mol. Weight

29.6 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged

Form

liquid
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Gene References into Functions

glycosylation changes the enzymatic activity of KLK2 in a drastically substrate-dependent manner. PMID: 26582203
The results indicated that W-hK2 had a defect in cellular trafficking due to its misfolding and that it activated the unfolded protein response, suggesting a mechanism to explain the association of the T allele with higher prostate cancer risk. PMID: 25847286
miR-378 was predicted to target both KLK2 and KLK4 and downregulated levels detected in prostate cancer patients. PMID: 25153390
The differential regulation of alternative transcripts (using KLK2, KLK3 and KLK4 as models) by androgens and anti-androgens as an indicator of prostate cancers, was investigated. PMID: 25153393
Structure-function analyses of KLK2 establish the 99-loop as master regulator of its activity. PMID: 25326387
Predictions based on levels of four kallikrein markers, including KLK2, in blood distinguish between pathologically insignificant and aggressive disease after radical prostatectomy with good accuracy. PMID: 23683475
Alteration of cellular junctions in benign prostatic hyperplasia could contribute to the presence of luminal epithelial secreted proteins prostate specific antigen (PSA)2 and and KLK2 in the stromal compartment. PMID: 24711254
we present the first evidence that KLK2 can also function as an androgen receptor modulator that may modulate cell growth after the development of castration-resistant prostate cancer PMID: 24122203
Associations observed in young, healthy men between the seminal plasma and serum concentrations of hK2 and PSA and several genetic variants in KLK2 and KLK3 could be useful to refine models of PSA cutoff values in prostate cancer testing. PMID: 24270797
Genetic variants at ATF7IP and KLK2 contribute to the variance of %fPSA. PMID: 23359319
Two SNPs, in beta-microseminoprotein at and in kallikrein-related peptidase 2 at, are associated with PCA3 score at genome-wide significance level PMID: 23555189
TK promotes vessel growth by increasing the number of EPCs and enhancing their functional properties through the kinin B(2) receptor-Akt signaling pathway. PMID: 22435954
An exploratory study of a KLK2 polymorphism as a prognostic marker in prostate cancer was found to be less likely associated with low Gleason score morphology. PMID: 21178268
we identifiedand genotyped novel single-nucleotide polymorphisms in cancer cases and controls which verified prior associations in KLK2 and in MSMB (but not in KLK3) with prostate cancer PMID: 20424135
Data show six non-synonymous amino acid or frame shift changes in the KLK3 gene and three changes in each of the neighboring genes, KLK15 and KLK2. PMID: 19823874
The identification of unusual mRNA splice variants of the KLK2 and KLK3 genes that result from inclusion of intronic sequences adjacent to the first exon. PMID: 11834722
Characterization of androgen receptor and nuclear receptor co-regulator expression in human breast cancer cell lines exhibiting differential regulation of kallikreins 2 and 3. PMID: 12124798
kallikrein expression in nipple aspirate fluid- ethnic variation PMID: 12209605
Measurements of free prostate specific antigen and hK2 improve on our ability to counsel patients prior to treatment as to their risk of biochemical recurrence PMID: 16152616
An additional serum marker for the detection of prostatic cancer. PMID: 16388506
a role for the KLK2 gene in prostate cancer susceptibility PMID: 17085659
results imply that prostate cancer risk is associated with androgen receptor(AR)-CAG repeat and kallikrein-2 polymorphisms in Indian population but no unambiguous association was observed with PSA and AR-GGN repeat polymorphism PMID: 17257635
role of kallikrein gene 2 and 3 variant SNPs in the etiology of prostate cancer among men of European ancestry PMID: 17593395
%fPSA and hK2 add important predictive value in older men and much closer to diagnosis PMID: 17657743
The two novel ETV4 fusion partners possess as predominant common characteristics androgen-induction and prostate-specific expression. PMID: 18451133
Recombinant hK2 activates ERK1/2 signaling of prostate cancer cell lines, which express both PAR1 and PAR2. PMID: 18567807
adding free PSA and human kallikrein 2 to standard pretreatment risk-assessment models to predict biochemical recurrence after radical prostatectomy for prostate cancer enhanced the AUC PMID: 19003994
PSA and kallikrein 2 transcripts in the peripheral blood of prostate cancer patients during barchytherapy could serve as a predictor of biochemiacl outcome. PMID: 19434652
Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator) PMID: 19223501

Hide All

Protein Families

Peptidase S1 family, Kallikrein subfamily

Database Links

HGNC: 6363

OMIM: 147960

KEGG: hsa:3817

STRING: 9606.ENSP00000313581

UniGene: Hs.515560

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-MP012453HU1
Abbreviation	Recombinant Human KLK2 protein (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human KLK2 at 2 μg/ml can bind Anti-KLK2 recombinant antibody (CSB-RA012453MA1HU). The EC₅₀ is 0.6741-0.8245 ng/mL. Biological Activity Assay Activity Measured by its ability to cleave a flourogenic peptide substrate Pro-Phe-Arg-7-amido-4-methylcoumarin (PFR-AMC). The specific activity is >350 pmol/min/µg. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Kallikrein-2 (KLK2) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage