Recombinant Human Keratin, type I cytoskeletal 10 (KRT10),Yeast

Code CSB-YP012504HU
MSDS
Size US$1675
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
BCIE; BIE; CK 10; CK-10; Cytokeratin-10; EHK; K10; K1C10_HUMAN; Keratin 10; Keratin 10 type I; Keratin; Keratin type i cytoskeletal 10; Keratin type I cytoskeletal 59 kDa ; Keratin-10; Keratin10; KPP; KRT10; type I cytoskeletal 10
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
326-443aa
Target Protein Sequence
EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.73kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the establishment of the epidermal barrier on plantar skin.; (Microbial infection) Acts as a mediator of S.aureus adherence to desquamated nasal epithelial cells via clfB, and hence may play a role in nasal colonization.; (Microbial infection) Binds S.pneumoniae PsrP, mediating adherence of the bacteria to lung cell lines. Reduction of levels of KRT10 keratin decrease adherence, overexpression increases adherence. Neither protein has to be glycosylated for the interaction to occur.
Gene References into Functions
  1. The molecular diagnostics by the whole exome sequencing showed a novel de novo (c.1374-2A>C) mutation in the KRT10 gene responsible for the development of IWC (KRT10 defect was confirmed by immunofluorescent study). Concurrently, the m.14484T>C mutation in mitochondrial MTND6 gene (characteristic for Leber's hereditary optic neuropathy or LHON) was detected in patient, his mother and brother PMID: 28944608
  2. KRT10 gene mutation was present in all of the affected individuals, but absent in the five unaffected and 100 ethnically-matched healthy controls. PMID: 27212473
  3. Mutations in the highly conserved helix initiation motif of K10 were associated with mild or severe form of epidermolytic ichthyosis PMID: 26373619
  4. Report genetic/clinical spectrum of KRT10 mutations in keratinopathic ichthyosis. PMID: 26581228
  5. We present an autosomal dominant pedigree with epidermolytic ichthyosis resulting from a new heterozygous missense mutation in keratin 10. PMID: 26338057
  6. recombinant adenovirus-mediated overexpression of KRT10 and PTEN may improve the cisplatin resistance of ovarian cancer in vitro and in vivo PMID: 26125866
  7. findings provide structural insights into phenotypic variation in epidermolytic ichthyosis due to KRT10 mutations PMID: 26176760
  8. The diagnosis of ichthyosis with confetti was confirmed by the identification of 2 previously unreported mutations in intron 6 and exon 7 of KRT10. PMID: 24626314
  9. We present the spectrum of clinical variability of ichthyosis with confetti in 6 patients with confirmed mutations in KRT10. PMID: 25210931
  10. Case Report: extensive postzygotic mosaicism for a novel keratin 10 mutation in epidermolytic ichthyosis. PMID: 24096702
  11. Data indicate that KRT10 is a downstream molecule of PTEN which improves cisplatin-resistance of ovarian cancer cells. PMID: 24434152
  12. Most of the orthokeratotic dysplasia constituent cells were immunopositive for keratin 10, but not for keratins 13, 17 or 19. PMID: 22734720
  13. Molecular mimicry between HSP 65 of Mycobacterium leprae and cytokeratin 10 of the host keratin play the role in pathogenesis of leprosy. PMID: 23121977
  14. Pneumococcal ligands K10, laminin receptor and platelet-activating factor receptor are elevated in aged lungs and contribute to the enhanced susceptibility to pneumonia. PMID: 21615674
  15. mapping and identifying disease-causing mutations in gene encoding KRT10 in ichthyosis with confetti; high frequency of somatic reversion suggests revertant stem cell clones are under positive selection and/or rate of mitotic recombination is elevated PMID: 20798280
  16. Data show that TIMP-1 and cytokeratin-10 were identified as 2 newly synthesized secreted proteins in PMID: 19904223
  17. Expression was altered in oral lichen planus lesions PMID: 19776502
  18. Mutations in codon 156 of K10, i.e. R156S, R156P, R156H were found in epidermolytic hyperkeratosis. PMID: 12234709
  19. cytokeratin 10 molecules were shown to be exposed on the surface of both desquamated nasal epithelial cells and keratinocytes; Staphylococcus aureus clumping factor B (ClfB) was shown to bind to cytokeratin K10 from the desquamated nasal epithelial cells PMID: 12427098
  20. Impaired NF-kappa B activation and increased production of tumor necrosis factor alpha is observed in transgenic mice expressing keratin K10 in the basal layer of the epidermis. PMID: 12566451
  21. normal cornified cell envelope is formed during the process of human epidermal keratinization, even if the suprabasal keratin filament network is disrupted as with this particular K10 mutation, M150T in BCIE PMID: 14705805
  22. cytokeratin 10 may have a role in progression of head and neck squamous cell carcinoma. PMID: 15254692
  23. We demonstrate that a recessive mutation in KRT10 leading to a complete human K10 knockout can cause EHK PMID: 16505000
  24. Candidate autoantigen in chronic, antibiotic-resistant Lyme arthritis. PMID: 16888010
  25. Squamous cell carcinoma (SCC) in mature cystic teratoma (MCT) expressed CK10 less frequently, but CK18 more frequently. SCC in MCT may be derived from metaplastic squamous epithelium. PMID: 17542994
  26. Mild recessive bullous congenital ichthyosiform erythroderma due to a previously unidentified homozygous keratin 10 nonsense mutation. PMID: 18219278
  27. siRNA for PRKD1 resulted in reduction of mRNA levels of PKD1, altered cell phenotype and promotion of keratinocyte differentiation, demonstrated by increased expression of involucrin and K10 mRNAs PMID: 18259765
  28. CK10 alone, or in combination with CK19, can be a novel predictor for poor prognosis of hepatocellular carcinoma patients after curative resection. PMID: 18559605
  29. EHK is an autosomal dominant disorder of keratinization, caused by mutations in either the KRT1 or KRT10 genes. Our patient presents EHK with palmoplantar involvement and KRT10 mutation. PMID: 19443303
  30. premature termination codon of KRT10 maybe involved in recessive epidermolytic hyperkeratosis PMID: 19474805
  31. Infection by HPV may alter the differentiation status of the epidermis, leading to delayed or absent expression of cytokeratin 10. PMID: 19515043

Show More

Hide All

Involvement in disease
Epidermolytic hyperkeratosis (EHK); Ichthyosis annular epidermolytic (AEI); Erythroderma, ichthyosiform, congenital reticular (CRIE)
Subcellular Location
Secreted, extracellular space. Cell surface.
Protein Families
Intermediate filament family
Tissue Specificity
Seen in all suprabasal cell layers including stratum corneum. Expressed on the surface of lung cell lines.
Database Links

HGNC: 6413

OMIM: 113800

KEGG: hsa:3858

STRING: 9606.ENSP00000269576

UniGene: Hs.99936

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*