Recombinant Human L-lactate dehydrogenase B chain (LDHB)

In Stock
Code CSB-EP012841HUc7
Abbreviation Recombinant Human LDHB protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
LDH heart subunit ;LDH-HRenal carcinoma antigen NY-REN-46
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-334aa
Target Protein Sequence
ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. High LDHB expression is significantly associated with the level of serum LDH and better clinical outcomes in lung squamous cell carcinoma PMID: 28756978
  2. this study shows that low base line lactate dehydrogenase is linked with a better tumor response, and that prolonged overall survival and progression-free survival are observed for patients under ipilimumab treatment with no increase in lactate dehydrogenase PMID: 27485076
  3. our study examines the inclusion of salivary LDH as potential diagnostic parameter and therapeutic index in Oral squamous cell carcinoma PMID: 26577856
  4. addition of exogenous lactic acid to growth media was sufficient to induce cell death that could be inhibited by the expression of LDHB. the results suggest that lactate dehydrogenase is a general suppressor of programmed cell death in yeast. PMID: 26032856
  5. The aim of this study was to demonstrate the effects of 6-week low-intensity training on changes in indicators of aerobic capacity and on HSPA1A, HSPB1, and LDHb expression in white blood cells in high level rowers. PMID: 26214432
  6. Lactate dehydrogenase B is associated with the response to neoadjuvant chemotherapy in oral squamous cell carcinoma. PMID: 25973606
  7. The readthrough-extended lactate dehydrogenase subunit LDHBx can also co-import LDHA, the other LDH subunit, into peroxisomes. PMID: 25247702
  8. We were able to provide evidence that methylation of HLTF and especially HPP1 detected in serum is strongly correlated with cell death in CRC using LDH as surrogate marker PMID: 24708595
  9. This meta-analysis shows that high serum LDH level is obviously associated with lower overall survival rate in patients with osteosarcoma, and it is an effective biomarker of prognosis. PMID: 24682390
  10. These observations support prospective clinical evaluation of LDHB as a predictive marker of response for patients with breast cancer receiving neoadjuvant chemotherapy. PMID: 23697991
  11. This study identifies LDHB as a regulator of cell proliferation in a subset of lung adenocarcinoma and may provide a novel therapeutic approach for treating lung cancer PMID: 23224736
  12. LDH concentrations in nasopharyngeal secretions are positively associated with acute otitis media risk. PMID: 23202721
  13. Loss of LDH-B expression is an early and frequent event in human breast cancer occurring due to promoter methylation, and is likely to contribute to an enhanced glycolysis of cancer cells under hypoxia. PMID: 23437403
  14. ata indicate that serum lactic dehydrogenase (S-LDH) appears to be a significant independent prognostic index in patients with metastatic nasopharyngeal carcinoma (NPC). PMID: 23266049
  15. Patients with severe vaso-occlusive crisis were more frequently males, who also had higher white blood cell (WBC) count, procalcitonin (PCT), and lactate dehydrogenase (LDH) levels. PMID: 22892192
  16. Data reveal that LDHB is upregulated and required only in certain cancer genotypes. PMID: 23139210
  17. results indicate that histone deacetylase inhibitors upregulate miRNAs, at least some of which act as tumor suppressors. lactate dehydrogenase B, which is regulated by the tumor suppressive miR-375, may therefore act as an oncogene in esophageal squamous cell carcinoma. PMID: 22752059
  18. Serum lactate dehydrogenase is a prognostic and predictive biomarker for survival benefit conferred by TORC1 inhibition in poor-risk renal cell carcinoma. PMID: 22891270
  19. Data indicate that serum lactate dehydrogenase (LDH) seemed able to predict clinical outcome for hepatocellular carcinoma (HCC) patients undergoing hepatocellular carcinoma (HCC). PMID: 22461886
  20. The significant elevation in serum CK [creatine kinase ]and LDH [L-Lactate Dehydrogenase ] activities indicates that these can be used as parameters for screening hypothyroid patients but not hyperthyroid patients. PMID: 22248949
  21. results confirmed the prognostic roles of LDH-B in urinary bladder urothelial carcinoma. PMID: 22027740
  22. Results suggest that lactate dehydrogenase B suppression plays an important role in triggering or maintaining the mitochondrial defects and then contributes to cancer cell invasiveness by inducing claudin-1 protein. PMID: 21356207
  23. Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency. PMID: 20499337
  24. findings offer proof of concept for targeting LDHB as a therapeutic strategy in cancers driven by aberrant activation of the RTK-PI3K-AKT-mTOR signaling cascade PMID: 21199794
  25. S100B and LDH are not expressed in sentinel node progression of melanoma PMID: 20592382
  26. LDHB was elevated in idiopathic myelofibrosis. This isoenzymatic pattern could be expression of a metabolic adaptation. PMID: 17178662
  27. MYC, LDHB, and CCNB1 may have roles in progression of medulloblastoma PMID: 18593994

Show More

Hide All

Involvement in disease
Lactate dehydrogenase B deficiency (LDHBD)
Subcellular Location
Cytoplasm. Mitochondrion inner membrane; Peripheral membrane protein.
Protein Families
LDH/MDH superfamily, LDH family
Database Links

HGNC: 6541

OMIM: 150100

KEGG: hsa:3945

STRING: 9606.ENSP00000229319

UniGene: Hs.446149

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*