Recombinant Human L-lactate dehydrogenase B chain(LDHB)

Code CSB-EP012841HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P07195
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias LDH heart subunit ;LDH-HRenal carcinoma antigen NY-REN-46
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Research Area Metabolism
Source E.coli
Gene Names LDHB
Expression Region 2-334aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 40.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Involvement in disease Lactate dehydrogenase B deficiency (LDHBD)
Subcellular Location Cytoplasm
Protein Families LDH/MDH superfamily, LDH family
Database Links

HGNC: 6541

OMIM: 150100

KEGG: hsa:3945

STRING: 9606.ENSP00000229319

UniGene: Hs.446149

Pathway Glucagon signaling pathway

Related Products

LDHB Antibodies

LDHB Antibodies for Homo sapiens (Human)

LDHB Proteins

LDHB Proteins for Homo sapiens (Human)

LDHB ELISA Kit

LDHB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.