Recombinant Human L-lactate dehydrogenase C chain (LDHC) ,partial

Code CSB-BP012844HU
Size US$2240Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names LDHC
Uniprot No. P07864
Research Area Cancer
Alternative Names Cancer/testis antigen 32; CT32; EC 1.1.1.27 ; L lactate dehydrogenase C chain; L-lactate dehydrogenase C chain; Lactate Dehydrogenase C; Lactate dehydrogenase c variant 1; Lactate dehydrogenase c variant 3; Lactate dehydrogenase c variant 4; Lactate dehydrogenase C4; LDH C; LDH testis subunit; LDH X ; LDH-C; LDH-X; LDH3 ; ldhc; LDHC_HUMAN; LDHX ; MGC111073
Species Homo sapiens (Human)
Source Baculovirus
Expression Region 2-332aa
Target Protein Sequence STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 38.2kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Possible role in sperm motility.
Gene References into Functions
  1. Lactate dehydrogenase C may act as a novel biomarker for renal cell carcinoma progression and a potential therapeutic target for the treatment of renal cell carcinoma. PMID: 28351304
  2. three uniquely identified proteins (CDK6 , galectin-3-binding protein and LDH C) were found, which show tight connection with prostate cancer and presence of all of them was previously linked to certain aspects of prostate cancer PMID: 26503549
  3. Down-regulated LDH-C4 expression is significantly correlated with lowered enzyme activity in human spermatozoa. PMID: 25795631
  4. This is the first report to show a positive correlation between LDH-3 and hemolytic parameters in sickle cell anemia. PMID: 26069337
  5. LDH3 was increased in essential thrombocythemia. This isoenzymatic pattern could be expression of a metabolic adaptation. PMID: 17178662
  6. LDH3 is a supporting diagnostic marker in cases of chronic tuberculosis. PMID: 17935709
  7. hLdhc expression in cancer cells was regulated by transcription factor Sp1 and CREB and promoter CGI methylation PMID: 18930904

Show More

Hide All

Subcellular Location Cytoplasm.
Protein Families LDH/MDH superfamily, LDH family
Database Links

HGNC: 6544

OMIM: 150150

KEGG: hsa:3948

STRING: 9606.ENSP00000280704

UniGene: Hs.654377

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1