Recombinant Human Left-right determination factor 2 (LEFTY2)

In Stock
Code CSB-EP012858HU
Abbreviation Recombinant Human LEFTY2 protein
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
EBAF; Endometrial bleeding associated factor (left right determination factor A transforming growth factor beta superfamily); Endometrial bleeding associated factor; Endometrial bleeding-associated factor; Left right determination factor 2; Left right determination factor A; Left-right determination factor 2; Left-right determination factor A; LEFTA; LEFTY 2; LEFTY2; LEFTYA; LFTY2 transforming growth factor; beta -4; LFTY2; mouse; homolog of; LFTY2_HUMAN; MGC46222; Protein lefty 2; Protein lefty A; Protein lefty-2; Protein lefty-A; Protein lefty2; PSEC0024; TGF beta 4; TGF-beta-4; TGFB4; Transforming growth factor beta 4; Transforming growth factor beta-4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
77-366aa
Target Protein Sequence
RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Inserting the gene encoding the Human LEFTY2 protein (77-366aa) into a plasmid vector results in the creation of recombinant plasmid, which is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected, indicating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is linked to the protein. After expression, affinity purification is used to isolate and purify the recombinant Human LEFTY2 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Human LEFTY2 protein, revealing a purity level exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for left-right (L-R) asymmetry determination of organ systems in mammals. May play a role in endometrial bleeding.
Gene References into Functions
  1. functional role of LEFTY during progesterone therapy for endometrial carcinoma PMID: 29268772
  2. LeftyA leads to disruption of Rac1 and Pak1 activity with subsequent actin depolymerization, cell softening and cell shrinkage. PMID: 27404958
  3. LEFTY2 down-regulates MKi67 expression and FAK activity, up-regulates miR-200a and E-cadherin, and is thus a powerful negative regulator of endometrial cell proliferation and migration. PMID: 27497669
  4. LEFTY2 regulates the expression and activity of ENaC in endometrial epithelial cells via SGK1. PMID: 27606670
  5. Lefty A may account for the tumor suppressive activity of human adult stem cells. PMID: 22469982
  6. Findings suggest that Lefty2 is negatively modulated by miR-302s in hESCs, which plays an important role in maintaining the balance between pluripotency and germ layer specification. PMID: 21266536
  7. Findings show that during embryonic development, EBAF/LEFTY B plays important roles in decidualization and embryo implantation. PMID: 21401636
  8. findings show that the TGFB4 (ebaf) mRNA has distinct tumor specific expression PMID: 9230066
  9. may provide a crucial signal for endometrial breakdown and bleeding by triggering expression of several matrix metalloproteinases PMID: 12215426
  10. nodal and the inhibitors of Nodal signaling, lefty-A and lefty-B, are down-regulated very early upon differentiation of human embryonic stem cells PMID: 15308665
  11. Addition of recombinant LEFTY-A to explants induced MMP-9 in most samples, a response prevented by ovarian steroids. PMID: 15536155
  12. LEFTY proteins, which are known to play a major role during mouse gastrulation, are transiently expressed during human embryonic stem cell differentiation. PMID: 17038673

Show More

Hide All

Involvement in disease
Left-right axis malformations (LRAM)
Subcellular Location
Secreted.
Protein Families
TGF-beta family
Tissue Specificity
Mesenchymal cells of the endometrial stroma.
Database Links

HGNC: 3122

OMIM: 601877

KEGG: hsa:7044

STRING: 9606.ENSP00000355785

UniGene: Hs.520187

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*