Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
EBAF; Endometrial bleeding associated factor (left right determination factor A transforming growth factor beta superfamily); Endometrial bleeding associated factor; Endometrial bleeding-associated factor; Left right determination factor 2; Left right determination factor A; Left-right determination factor 2; Left-right determination factor A; LEFTA; LEFTY 2; LEFTY2; LEFTYA; LFTY2 transforming growth factor; beta -4; LFTY2; mouse; homolog of; LFTY2_HUMAN; MGC46222; Protein lefty 2; Protein lefty A; Protein lefty-2; Protein lefty-A; Protein lefty2; PSEC0024; TGF beta 4; TGF-beta-4; TGFB4; Transforming growth factor beta 4; Transforming growth factor beta-4
Species
Homo sapiens (Human)
Expression Region
77-366aa
Target Protein Sequence
RFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Inserting the gene encoding the Human LEFTY2 protein (77-366aa) into a plasmid vector results in the creation of recombinant plasmid, which is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected, indicating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is linked to the protein. After expression, affinity purification is used to isolate and purify the recombinant Human LEFTY2 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Human LEFTY2 protein, revealing a purity level exceeding 85%.