Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

LEP

Uniprot No.

P41159

Research Area

Signal Transduction

Alternative Names

FLJ94114; LEP; LEP_HUMAN; LEPD; Leptin (murine obesity homolog); Leptin (obesity homolog, mouse); Leptin; Leptin Murine Obesity Homolog; Leptin Precursor Obesity Factor; OB; Obese protein; Obese, mouse, homolog of; Obesity; Obesity factor; Obesity homolog mouse; Obesity Murine Homolog Leptin; OBS; OTTHUMP00000212285

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

29-164aa

Target Protein Sequence

DDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.0kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human LEP protein synthesis in e.coli cells necessitates the incorporation of a DNA fragment encoding the Human LEP protein (29-164aa) into a plasmid vector, followed by the transformation of this vector into e.coli cells. After screening for positive cells, they are cultured and induced to express the LEP protein. The protein carries a N-terminal 6xHis tag. Cell lysis is performed to gather the recombinant Human LEP protein, which undergoes affinity purification and is then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human LEP protein reaches up to 90%.

Target Background

Function

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways. In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity. In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides. In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption. Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways. May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression. Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs). In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells. Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 wich promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38. In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses. Increases CD4(+)CD25(-) T-cell proliferation and reduces autophagy during TCR (T-cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation.

Gene References into Functions

chemerin and leptin are elevated and omentin-1 and visfatin levels are decreased in Gestational diabetes mellitus women complicated by obesity. PMID: 29337272
study demonstrated novel molecular events for leptin-induced inflammation in ligamentum flavum (LF) tissue by promoting IL-6 expression and thus might have potential implications for clarifying the mechanism underlying LF fibrosis and hypertrophy. PMID: 29436483
Leptin protein was significantly elevated in pre-liver transplantation alcoholics and was lowered post-transplantation. PMID: 29912265
The AA genotype of leptin rs7799039 is associated with metabolic syndrome and higher serum leptin levels in Egyptian women PMID: 27966294
In critically ill heart failure patients, the circadian rhythm of plasma leptin concentration seems to be preserved during the first but not during the third day after admission. PMID: 29527917
a potential link between gastric leptin and microbial-derived metabolites in the context of obesity and diabetes PMID: 29851973
Results show that LEP rs7799039 allele A was slightly associated with reduced total and LDL cholesterol suggesting that LEP genetic variant may be useful biomarker of cardiometabolic risk in obese patients. PMID: 28975585
The aim of this study was to determine serum ghrelin and leptin levels in obese and lean Saudi women with Polycystic ovary syndrome and to investigate their relationship to the metabolic profiles in these women. PMID: 30131073
The serum leptin level does not differ significantly between non-obese OSA patients with moderate/severe and snoring/mild OSA. PMID: 29174427
Leptin concentrations are higher in the obese group irrespective of their glucose tolerance PMID: 29108900
Leptin-to-adiponectin ratio and IL-6 were elevated in men with prostate cancer. Leptin, chemerin and IL-6 were associated with Gleason score. The relationships between leptin, chemerin and IL-6 were dependent on each other. PMID: 29465157
Results provide new evidences for a modulatory effect of leptin in regulation of ovarian cancer cell invasion by stimulating MMP7 expression via ERK and JNK pathways. PMID: 28885729
this study shows that leptin regulates the pro-inflammatory response in human epidermal keratinocytes PMID: 29468452
AMH, IGF1 and leptin levels in follicular fluid have no relation to the fertility disorders caused by endometriosis or fallopian tube damage, though they are biomarkers for anovulatory fertility disorders. PMID: 29595066
Our data provide evidence that leptin-mediated OPN upregulation promote TH2 inflammation in AR and this process is achieved through the alpha4 integrin and PI3K/AKT signaling pathways. PMID: 29885866
By functional analysis based on a set of 1129 proteins from 494 obese subjects study identified and validated FAM46A as a trans regulator for leptin. PMID: 29234017
Cord blood klotho levels were inversely correlated with leptin and insulin levels at birth PMID: 29648999
Estradiol and physical activity were stronger predictors of leptin at menses, while sexual activity was a stronger predictor of leptin at ovulation. These findings suggest that predictors of serum leptin, and possibly energy storage and expenditure, vary across the menstrual cycle. PMID: 29454804
leptin, leptin receptor and apelin receptor genes are associated with susceptibility to coronary artery disease and hypertension PMID: 29883719
Serum levels of leptin (and adiponectin) were significantly and negatively associated with bone mineral density in patients with knee osteoarthritis. PMID: 29343264
This study provides evidence that polymorphisms in the LEP and LEPR genes are associated with the magnitude of the effects of regular physical activity on glucose and LDL-C levels, respectively. In addition, we found the association of the G allele of the LEPR polymorphism with body mass and BMI PMID: 29373433
Increased levels of mucosal leptin may interact with mast cells and the nervous system to contribute to the pathogenesis of diarrhea-predominant irritable bowel syndrome. PMID: 29358881
Data suggest that expression of aquaporin-9 in term placenta is up-regulated by leptin. These studies used placental explants following term birth via cesarean section. PMID: 28942694
by analyzing different estrogen receptor-alpha(ER-a)-positive and ER-a-negative breast cancer cell lines, we defined the role of CCN5 in the leptin-mediated regulation of growth and invasive capacity. PMID: 29370782
LEP-rs7799039 was significantly associated with an increased risk for excessive gestational weight gain. PMID: 29241578
Higher serum leptin levels can be used as a risk factor for childhood obesity. PMID: 29412799
H. pylori infection decreased serum concentrations of leptin and obestatin in Mexican schoolchildren, suggesting alterations in regulating appetite and energy homeostasis. PMID: 28422951
Data suggest that the stimulatory effects of leptin on proliferative activity of human normal prostate and prostate cancer cell lines require the expression of leptin receptor variant 1 in the affected cells. PMID: 29115533
The findings suggest that the LEP G2548A genetic polymorphism may increase the susceptibility of cancers in non-Hodgkin's lymphoma (meta-analysis). PMID: 25536622
Features of poor prognosis such as tumor invasion, lymph node involvement and distant metastasis have been recorded in several cancer types with higher levels of leptin and/or Ob-R. This review will describe the current scenario in a precise manner. In general, obesity indicates poor prognosis in cancer patients. [Review] PMID: 29158066
Clinical data on secondary hyperparathyroidism, mainly derived from patients with chronic kidney disease, indicate a potential inverse association between leptin (LEP) and parathyroid hormone (PTH) in some, but not all studies. [REVIEW] PMID: 28730419
Data suggest that transient increases in plasma adiponectin levels and transient decreases in plasma leptin levels occur following high-intensity interval exercise in overweight and obese young women. These studies were conducted in Turkey in formerly sedentary women ages 20-30 years. PMID: 28857629
There was no simple, linear association of leptin and physical activity in adults with anorexia nervosa. PMID: 29099750
Neoplastic cells appeared unable to downregulate NOX5 mRNA expression under leptin. Leptin emerged as a potential activator of ROS production in human epithelial mammary cells, where the ROS production was apparently linked to NOX5 activation. This novel finding could shed light on the potential role of obesity-associated hyperleptinemia in mammary cells via the activation of NOX enzymes PMID: 29048637
Data suggest that serum leptin may be a potential biomarker for predicting sarcopenic obesity and physical performance in knee osteoarthritis. PMID: 28374624
Leptin synergizes with IL-1beta in inducing ELF3 expression in chondrocytes. PMID: 29550824
The nitrogen stable isotopic ratio in hair is positively associated with serum leptin levels. PMID: 29081462
Heterozygous genotype AG of Single Nucleotide Polymorphism -2548 G/A of leptin gene (LEP) may reduce the risk of endometrial cancer independently of overall adiposity of an individual. Allele A alone of the studied polymorphism may be a risk factor of this malignancy in obese women, whereas allele G may decrease the hazard in these patients. PMID: 28964972
Pregnant adolescents with leptin concentration over 20 ng/mL showed a greater gestational weight gain. Leptin concentration correlated with length and weight of the newborn. PMID: 28953229
LEP and LEPR single-nucleotide polymorphisms are not associated with genetic susceptibility to systemic lupus erythematosus. PMID: 28244652
The upregulation of miR27 inhibits the pathogenesis of osteoarthritis by targeting leptin and inhibiting the NF-kappaB signaling pathway. PMID: 28627582
There was a direct association between the polymorphisms in LEP rs7799039 and ADIPOQ rs1501299 with overweight/obesity, and these genotypes affected the response to breast cancer chemotherapeutic treatment in Mexican women PMID: 28416193
Habitual intake of SFA, MUFA, and n-3 fatty acids were associated with leptin gene expression in visceral and subcutaneous adipose tissues, suggesting an important role of quality and quantity of fatty acids intake in adipose tissue to regulate leptin expression. PMID: 29031395
The studies established a potential link between leptin and adipocyte insulin responsiveness in an NOS2 dependent manner. PMID: 28739528
Leptin serum levels drop following bariatric surgery and is predictive of disease remission in type 2 diabetes mellitus patients. PMID: 28734574
alterations in leptin and SCD-1 in HCU patients PMID: 28801090
leptin may have a role in androgenetic alopecia in men PMID: 28423238
study is the first to describe the mechanism of leptin-promoted lymphangiogenesis by upregulating VEGF-C expression in chondrosarcomas. PMID: 27345723
The study suggested that leptin accelerated the epithelial mesenchymal transition of A549cells through inhibiting autophagy via PI3K/Akt/mTOR pathway. PMID: 29524411
Studied adiponectin (ADIPOQ), leptin (LEP), leptin receptor (LEPR), and resistin (RETN) single nucleotide polymorphisms and their association in obesity. Results showed that ADIPOQ 4522CPMID: 28195351

Hide All

Involvement in disease

Leptin deficiency (LEPD)

Subcellular Location

Secreted.

Protein Families

Leptin family

Tissue Specificity

Adipose tissue is the main source of leptin. It is also produced by other peripheral tissues such as the skeletal muscle. Expressed by intercalated and striated tracts of submandibular and parotid salivary gland intralobular ducts. Detected by fundic epit

Database Links

HGNC: 6553

OMIM: 164160

KEGG: hsa:3952

STRING: 9606.ENSP00000312652

UniGene: Hs.194236

Code	CSB-RP067974h
Abbreviation	Recombinant Human LEP protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Leptin (LEP), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage