Recombinant Human Leukosialin (SPN), partial

Code CSB-MP022590HU
Abbreviation Recombinant Human SPN protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
GPL115;Galactoglycoprotein;Leukocyte sialoglycoprotein;Sialophorin
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
20-253aa
Target Protein Sequence
STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Predominant cell surface sialoprotein of leukocytes which regulates multiple T-cell functions, including T-cell activation, proliferation, differentiation, trafficking and migration. Positively regulates T-cell trafficking to lymph-nodes via its association with ERM proteins (EZR, RDX and MSN). Negatively regulates Th2 cell differentiation and predisposes the differentiation of T-cells towards a Th1 lineage commitment. Promotes the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation of naive cells and induces the expression of IFN-gamma by CD4(+) T-cells and to a lesser extent by CD8(+) T-cells. Plays a role in preparing T-cells for cytokine sensing and differentiation into effector cells by inducing the expression of cytokine receptors IFNGR and IL4R, promoting IFNGR and IL4R signaling and by mediating the clustering of IFNGR with TCR. Acts as a major E-selectin ligand responsible for Th17 cell rolling on activated vasculature and recruitment during inflammation. Mediates Th17 cells, but not Th1 cells, adhesion to E-selectin. Acts as a T-cell counter-receptor for SIGLEC1.; Protects cells from apoptotic signals, promoting cell survival.
Gene References into Functions
  1. CD43 expression was 95.7% in atypical chronic lymphocytic leukemia cases. PMID: 28713070
  2. most non-hematopoietic neoplasms are negative for CD43 expression PMID: 28807337
  3. this study identifies a new signaling pathway for CD43 through the regulation of alternative functions of pyruvate kinase isoform M2, favoring cell survival following activation PMID: 27606486
  4. Forty percent of adenoid cystic carcinomas showed staining for CD43, while no cases of basal cell carcinoma were positive PMID: 25551301
  5. CD43 expression is a novel adverse prognostic factor for patients with diffuse large B-cell lymphomas PMID: 25682152
  6. CD43 polymorphisms are associated with TB susceptibility. PMID: 25078322
  7. Host membrane protein PSGL-1, CD43, and CD44 association with assembling HIV-1 Gag is driven by polybasic sequences present in the cytoplasmic tails of the membrane proteins and in Gag. PMID: 25320329
  8. When used as vaccine in mice, the 2/165 phagotope raised antibodies against the UN1/CD43 antigen, indicating that the 2/165 phagotope mimicked the UN1 antigen structure, and could represent a novel immunogen for cancer immunotherapy PMID: 24356816
  9. CD43 promotes cells transformation by preventing merlin-mediated contact inhibition of growth. PMID: 24260485
  10. We conclude that CD43 is an adverse prognostic marker in DLBCL, and is preferentially expressed in the non-GCB subgroup. PMID: 23617469
  11. CD43 regulates the threshold for T cell activation by targeting Cbl functions. PMID: 21905200
  12. Taken together, these results show that elevated calcium levels induce CD43 capping, and macrophages remove the cells if their nucleolin receptors can bind to the poly-N-acetyllactosaminyl chains of capped CD43. PMID: 23400223
  13. Targeting CD43 in A549 lung cancer cells, increased homotypic adhesion, decreased heterotypic adhesion and transendothelial migration, increased susceptibility to apoptosis and increased vulnerability to lysis by NK cells PMID: 23015282
  14. results suggest that, despite the high CD43 expression in both tumorous and nontumorous Langerhans cells (LCs), the JL1 epitope of CD43 is exposed in immature and neoplastic LCs. PMID: 22790855
  15. Compared to healthy controls, both CD43 mRNA and protein expressions were reduced in T cells from patients with SLE, and were inversely correlated with IgG. PMID: 22613599
  16. CD43 localizes to the nucleus, where it binds chromatin, co-localizes and co-immunoprecipitates with beta-catenin, and enhances the reporter gene expression regulated by beta-catenin PMID: 22576689
  17. The capping of CD43 on the cell surface is a strong signal for phagocytosis that allows phagocytes to differentiate between healthy and apoptotic cells without any additional membrane changes PMID: 22466560
  18. The anti-adhesive function of CD43 in colon carcinoma cells plays a role in the tumorigenesis and metastasis of colorectal carcinoma cells. PMID: 22075155
  19. there exists a negative feedback loop between p53 and CD43: CD43-dependent signaling activates p53, which in turn downregulates the expression of CD43 PMID: 21947346
  20. O-glycosylated CD43 and CD45 molecules on T cells regulates cell adhesion and favors the transmission of HTLV-1 from cell to cell. PMID: 22171268
  21. Data show that Pic, a class 2 SPATE protein produced by Shigella flexneri 2a targets a broad range of human leukocyte glycoproteins including CD43, CD44, CD45, CD93, CD162 and the surface-attached chemokine fractalkine. PMID: 21768350
  22. identification of the tumor antigen UN1 as the transmembrane CD43 sialoglycoprotein PMID: 21372249
  23. Expression of CD43 induces cell rounding, inhibition of cell re-attachment, augmentation of microvilli, and phosphorylation of Ezrin/Radixin/Moesin (ERM)in HEK293T cells. PMID: 21045567
  24. engagement of CD43 may, presumably through the repressing transcription, initiate a Bad-dependent apoptotic pathway. PMID: 11773067
  25. CD43 can be seen as a co-stimulatory cell surface constituent that can modulate HIV-1 expression in T lymphocytes PMID: 12045189
  26. down-regulation of CD43 mRNA levels occurs during activation of the cellline K562. This repression coincides with repression of the transcriptional activity of the CD43 gene promoter. PMID: 12411317
  27. Examination of expression of CD43 in different human cell lines and tumor cell lines PMID: 12499775
  28. Although ezrin-associated CD43 protein is excluded from the inhibitory, i.e., noncytolytic, NK cell immune synapse (IS), it is homogeneously distributed across the IS of activating conjugates. PMID: 12626536
  29. It was also observed that the mucins from colon carcinoma patients had MUC1-type mucins that carried both sialyl-Lewis a and x epitopes and CD43-type sialyl-Lewis a mucins with only low levels of sialyl-Lewis x epitopes. PMID: 12820726
  30. CD43 engagement on normal human T lymphocytes as well as in Jurkat cells results in transient phosphorylation of the zeta-chain and enhanced association of ZAP-70 and Vav to the zeta-chain. PMID: 12902492
  31. Overexpression of SPN causes activation of the tumor suppressor proteins p53 and ARF 1. PMID: 14676827
  32. Four phage antibodies were isolated and used in a preliminary immunohistochemistry study of CD43 expression on frozen colorectal adenoma and carcinoma tissue. PMID: 14719063
  33. findings suggest that the CD43 molecules expressed on CD4+ memory T cells may be capable of enhancing the costimulatory signaling and hence providing accessory functions to TCR-mediated activation processes PMID: 15187099
  34. Microarray analysis of inflammatory genes shows 1 group of genes coregulated by both stimuli and 2 further groups of target genes affected solely by costimulation or primarily by CD43. PMID: 15280197
  35. CD43 is expressed by a variety of carcinoma cell lines, and plays a role in tumour cell-peritoneal adhesion probably via interactions with its putative ligand ICAM-1 PMID: 15449712
  36. Data suggest that PKCtheta plays a critical role in the co-stimulatory functions of CD43 in human T cells. PMID: 15522211
  37. CD43 is a T-cell E-selectin ligand distinct from PSGL-1 which expands the role of CD43 in the regulation of T-cell trafficking. PMID: 16269612
  38. CD43 induces a signaling cascade that prolongs the duration of T cell receptor signaling, thereby supporting the temporality with which certain molecules are engaged as a mechanism to fine tune T cell signal quality, and ultimately immune function. PMID: 16751378
  39. early progenitors committed to hematopoietic development could be identified by surface expression of leukosialin PMID: 16757688
  40. Promotes cell growth and is a potential contributor to tumor development. PMID: 17891181
  41. Lymphoepithelial lesions pattern, CD43 coexpression, and clonal plasma cell component in extranodal marginal zone B-cell lymphoma (EMZL) is site-dependent, and the differences may aid in the diagnosis of EMZLs at different anatomic sites. PMID: 17979485
  42. triggering CD43 and the underlying signaling pathways enhance LFA-1 adhesiveness while CD43 also negatively regulates LFA-1 induction via other receptors by dynamic interaction with either LFA-1 or CD147. PMID: 17996943
  43. CD43 seems to be selectively expressed in a subset of adenoid cystic carcinomas and its significance in salivary tumors is discussed. PMID: 18227725
  44. The cleavage of neutrophil leukosialin (CD43) by cathepsin G releases its extracellular domain and triggers its intramembrane proteolysis by presenilin/gamma-secretase PMID: 18586676
  45. Streptococcus gordonii DL1 surface protein Hsa binds to the host cell membrane glycoproteins CD11b, CD43, and CD50 PMID: 18678668

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Cell projection, microvillus. Cell projection, uropodium.; [CD43 cytoplasmic tail]: Nucleus. Nucleus, PML body.
Tissue Specificity
Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
Database Links

HGNC: 11249

OMIM: 182160

KEGG: hsa:6693

STRING: 9606.ENSP00000353238

UniGene: Hs.632188

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*