Recombinant Human Leukosialin(SPN)

Code CSB-CF022590HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P16150
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP
Source in vitro E.coli expression system
Gene Names SPN
Protein Names Recommended name: Leukosialin Alternative name(s): Galactoglycoprotein Short name= GALGP Leukocyte sialoglycoprotein Sialophorin CD_antigen= CD43
Expression Region 20-400
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function One of the major glycoproteins of thymocytes and T lymphocytes. Plays a role in the physicochemical properties of the T-cell surface and in lectin binding. Presents carbohydrate ligands to selectins. Has an extended rodlike structure that could protrude above the glycocalyx of the cell and allow multiple glycan chains to be accessible for binding. Is a counter-receptor for SN/Siglec-1 (By similarity). During T-cell activation is actively removed from the T-cell-APC (antigen-presenting cell) contact site thus suggesting a negative regulatory role in adaptive immune response (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
Database Links

HGNC: 11249

OMIM: 182160

KEGG: hsa:6693

STRING: 9606.ENSP00000353238

UniGene: Hs.632188

Related Products

SPN Antibodies

SPN Antibodies for Homo sapiens (Human)

SPN Antibodies for Human

SPN Antibodies for

SPN Proteins

SPN Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.