Recombinant Human Lipopolysaccharide-binding protein (LBP), partial

In Stock
Code CSB-EP012775HU1
Abbreviation Recombinant Human LBP protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
(LBP)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
304-414aa
Target Protein Sequence
TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : / Sample species: cells

Review: IL-6, (e) IL-1β, were measured in the supernatants of LPS-stimulated RAW 264.7 cells.

By Anonymous

Target Background

Function
Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. Acts as an affinity enhancer for CD14, facilitating its association with LPS. Promotes the release of cytokines in response to bacterial lipopolysaccharide.
Gene References into Functions
  1. This study shows a remarkable reversal of amyloid fibrin formation by LBP addition to the plasma of Parkinson's Disease patients . PMID: 29494603
  2. Serum LBP levels are associated with arterial stiffness, independent of obesity and traditional cardiovascular risk factors, especially in men with type 2 diabetes. PMID: 28486964
  3. novel observation that sCD14 compared with lipopolysaccharide binding protein, offers a preferred target to ameliorate TLR especially TLR4-induced inflammation and insulin resistance in human obesity and metabolic syndrome PMID: 26880233
  4. LBP, an endotoxemia associated protein might be used as an inflammatory biomarker of both infectious and non-infectious origins in HCV-infected subjects PMID: 28107471
  5. Data show that after matching for gender, age, and body mass index (BMI), serum lipopolysaccharide-binding protein (LBP) does not improve prediction of the development of type 2 diabetes mellitus (T2DM) independently. PMID: 25753130
  6. The main findings of this study are that, in acute stroke patients, levels of LBP, IL-10, IL-6 and CRP show a different time course in patients with and without post-stroke infection. PMID: 25613713
  7. Serum LBP level is significantly elevated in polycystic ovary syndrome women and is associated with insulin resistance. PMID: 26799617
  8. LBP serves not only as an extracellular LPS shuttle but in addition facilitates intracellular transport of LPS. PMID: 26804480
  9. LBP level was not significantly different in neutropenic systemic inflammatory response syndrome patients and sepsis patients. PMID: 26046926
  10. Report increased secretion of Fetuin A, LBP and HMGB-1 from subcutaneous adipose tissue in metabolic syndrome. PMID: 25978344
  11. Low levels of microbial translocation marker LBP are associated with sustained viral response after anti-HCV treatment in HIV-1/HCV co-infected patients PMID: 25785448
  12. serum level elevated in late-onset neonatal sepsis in very low birth weight infants PMID: 25014514
  13. Adjusting for body mass index and waist circumference, LBP levels remained significantly increased in metabolic syndrome and increased with increasing numbers of MetS risk factors. PMID: 25063948
  14. study suggested that elevated plasma LBP was associated with an increased risk of developing MetS among middle-aged and older Chinese, especially in normal-weight individuals. PMID: 24906952
  15. In preterm neonates born to asymptomatic women with PPROM, LBP in cord blood at delivery is an excellent diagnostic biomarker of Fetal inflammatory response syndrome/funisitis with prognostic potential. PMID: 24335151
  16. report pre-ART IL-6 and LBP levels as well as IL-6, LBP and I-FABP levels during IRIS-event as potential biomarkers in TB-IRIS PMID: 24312369
  17. In childnre, LBP was independently associated with BMI and with measures of obstructive sleep apnea severity as well as with metabolic dysfunction, particularly insulin resistance as indicated by the homeostasis model assessment of insulin resistance. PMID: 24276451
  18. Suggest that the serum LBP concentration constitutes a reliable biologic marker for the diagnosis of a febrile urinary tract infection in children. PMID: 23463341
  19. Mutations in the lipopolysaccharide binding protein impair innate immunity. PMID: 24120359
  20. Serum LBP concentrations increased with age. Overweight, obesity, and having metabolic syndrome (particularly, low HDL cholesterol levels) were associated with higher LBP concentrations PMID: 23349936
  21. expression in oral keratinocytes is stimulated by Porphyromonas gingivalis LPS PMID: 22736337
  22. Human lipopolysaccharide-binding protein (LBP) and CD14 independently deliver triacylated lipoproteins to Toll-like receptor 1 (TLR1) and TLR2 and enhance formation of the ternary signaling complex PMID: 23430250
  23. LBP is a surrogate marker of microbial translocation in association with physical functioning of older adults. PMID: 22960476
  24. Association of lipopolysaccharide-binding protein gene polymorphisms with cerebral infarction in a Chinese population PMID: 22476641
  25. our study demonstrated that an elevated LBP level of >15000 ng/ml may serve as a biomarker for the prediction and monitoring of aGVHD. PMID: 22552880
  26. During the first 14 days of postoperative sepsis, LBP plasma concentrations showed a time course that was very similar to CRP with a high concordance in the pattern of day-to-day changes PMID: 21901123
  27. The availability of commercial methods for the automated measurement of the soluble CD14 subtype presepsin and lipopolysaccharide binding protein represent a challenge for the evaluation in clinical practice of reliable markers of neonatal sepsis. PMID: 21740312
  28. Aseptic trauma primes the innate immune system for the posttraumatic release of lipopolysaccharide binding protein and sCD14 PMID: 21722015
  29. Cytokine concentrations in amniotic fluid during the mid-trimester did not differ with parity or fetal gender. IL-6, IL-8, and LBP levels appeared stable with gestational week (GW), whereas GW significantly influenced TNF-alpha concentrations. PMID: 21702700
  30. LBP measurements performed shortly after preterm premature rupture of membranes, are not of value either in the prediction of newborn's infection, or in the prognosis of latency period duration. PMID: 21353369
  31. This study highlights the LBP rs2232596 and CD14 rs4914 polymorphisms as biomarkers for elevated colorectal carcinoma susceptibility in the Chinese Han population PMID: 21633598
  32. High LBP is associated with Crohn's disease. PMID: 20865702
  33. Elevated circulating LBP was associated with obesity, metabolic syndrome, and type 2 diabetes in apparently healthy Chinese. PMID: 20530747
  34. The association of the polymorphisms c.291C>T and c.613A>G suggest a role of LBP in the disease manifestation of infective endocarditis. PMID: 19560454
  35. Serial LBP serum measurements may offer a clinically useful biomarker for identification of patients with severe sepsis having the worst outcomes and the highest probability of developing sepsis-induced ARDS PMID: 19718443
  36. carboxyl-terminal domain of these closely related endotoxin-binding proteins dictates the route and host responses to complexes they form with endotoxin. PMID: 11773072
  37. a new and reliable infection marker after kidney transplantation PMID: 11976738
  38. Identification of single amino acid residues essential for the binding of lipopolysaccharide (LPS) to LPS binding protein (LBP) residues 86-99 by using an Ala-scanning library PMID: 11991204
  39. plasma factor LBP and cell surface receptor CD14 were necessary for LPS activation of p38, which was tightly associated with LPS priming of the PMN respiratory burst PMID: 12117913
  40. Besides a role in the detoxification of bacterial toxin present in the circulation, LBP-chylomicron complexes may be part of a local defense mechanism of the intestine against translocated bacterial toxin. PMID: 12538700
  41. innate immune recognition of LTA via LBP, CD14, and TLR-2 represents an important mechanism in the pathogenesis of systemic complications in the course of infectious diseases brought about by Gram-positive pathogens. while TLR-4 and MD-2 are not involved. PMID: 12594207
  42. Single nucleotide polymorphism of the LBP gene is not assciated with complicated sepsis after trauma. PMID: 12615620
  43. data support the hypothesis that lipopolysaccharide binding protein can inhibit cell responses to lipopolysaccharide(LPS) by inhibiting LPS transfer from membrane CD14 to the Toll-like receptor 4-MD-2 signaling receptor PMID: 12754215
  44. plays an essential role in the innate immune response to Gram-positive pneumococci PMID: 12932360
  45. In critically ill neonates aged over 48 h and children lipopolysaccharide binding protein is a better marker than procalcitonin, interleukin-6 and C-reactive protein. PMID: 15127192
  46. Dual role of LBP and CD14 in initiation of proinflammatory signaling and clearance or neutralization of LPS. PMID: 15618154
  47. studies suggest that SP-A could contribute to modulate Re-LPS responses by altering the competence of the LBP-CD14 receptor complex PMID: 15932345
  48. LBP mediates the fusion of lipid membranes and LPS aggregates. PMID: 16303759
  49. Human pulmonary LBP acts as an important modulator of the LPS response in the respiratory tract in vivo. PMID: 16493079
  50. Significantly elevated serum concentrations of LBP and sCD14 are found in severe sepsis patients. PMID: 16512634

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic granule membrane.
Protein Families
BPI/LBP/Plunc superfamily, BPI/LBP family
Tissue Specificity
Detected in blood serum (at protein level).
Database Links

HGNC: 6517

OMIM: 151990

KEGG: hsa:3929

STRING: 9606.ENSP00000217407

UniGene: Hs.154078

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*