Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial

In Stock
Code CSB-EP008544HU1
Abbreviation Recombinant Human FCGR3B protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
18-125aa
Target Protein Sequence
MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene References into Functions
  1. SHP-2 is activated by CD16b crosslinking in neutrophils. PMID: 29137913
  2. FCGR3B deficiency due to copy number variations may predispose to eosinophilic granulomatosis with polyangiitis. PMID: 26684293
  3. The FCGR3B NA1/NA1 genotype is associated with hypersensitivity reactions to adalimumab in Japanese patients with Rheumatoid Arthritis. PMID: 27830964
  4. Data suggest association of FCGR3B deletion with increased risk of rheumatoid arthritis (RA) in a large cohort. PMID: 27995740
  5. Association between Fc gamma Receptor IIIB genetic polymorphisms and susceptibility to severe malaria anemia in children in western Kenya. PMID: 28427365
  6. CD16 and CD35 are important for neutrophil internalization of M. tuberculosis, whereas HIV-1 infection adversely affects opsonophagocytosis. PMID: 27258232
  7. There was no aberration in FCGR3B allele/genotype frequencies in sarcoidosis patients compared to controls. PMID: 26801149
  8. Results showed that susceptibility to systemic lupus erythematosus was associated with the FCGR3B*01 allele, as well as with the FCGR3B*01/*01 and FCGR3B*01/*02 genotypes. PMID: 26946294
  9. FcgammaRIIIB allelic distribution was similar among pediatric Guillain-Barre syndrome patients and controls. PMID: 27064330
  10. data show that cross-linking FcgammaRIIIb is responsible for NET formation by the human neutrophil PMID: 27034964
  11. the results of this meta-analysis indicated that low FCGR3B CN increased susceptibility to autoimmune diseases--{REVIEW} PMID: 26407570
  12. FCGR3B copy number related to systemic lupus and lupus nephritis susceptibility. PMID: 24673810
  13. No relationship was found between the FCGR3B polymorphism and rheumatoid arthritis susceptibility. PMID: 26314337
  14. This study compared the FCGR3B gene frequencies among 230 unrelated healthy Eastern Thai blood donors in Rayong hospital with the previously published studies. PMID: 25626603
  15. FcgammaRIIIb polymorphism is not associated with susceptibility to systemic lupus erythematosus in Brazilian patients PMID: 24896836
  16. in the Indian population, FCGR3B gene copy number varied significantly when compared to other populations of the world. PMID: 25428402
  17. A high copy number of FCGR3B is associated with psoriasis vulgaris in Han Chinese. PMID: 25012234
  18. This suggests that FcgammaRIIIb signals in association with macrophage-1 Ag. PMID: 25024378
  19. The frequencies of FCGR3B*1, FCGR3B*2, and FCGR3B*3 alleles in central Thai blood donors were 0.548, 0.452, and 0.004. PMID: 24205492
  20. Copy number of polymorphisms in FCGR3B gene is associated with ulcerative colitis. PMID: 23917248
  21. The absolute risk of malaria decreased more rapidly with increasing antibody levels for Fc gamma receptor 3B 233AA/AC individuals compared with 233CC children. PMID: 23935200
  22. The FCGR3B NA1/NA2 polymorphism may be associated with susceptibility to aggressive periodontitis. PMID: 23649770
  23. study concludes gene copy number of FcgammaR2C and FcgammaR3B influences IVIG treatment response and predisposes individuals to Kawasaki disease, providing potential insights into understanding the mechanism of the FcgammaR gene family in the IVIG pathway PMID: 23778324
  24. Allele frequencies were determined in the blood donor population as follows: 0.318 for HNA-1a, 0.668 for HNA-1b, 0.014 for HNA-1c, 0.768 for HNA-3a, 0.232 for HNA-3b, 0.882 for HNA-4a, 0.118 for HNA-4b, 0.736 for HNA-5a and 0.264 for HNA-5b. PMID: 23398146
  25. Higher CD16+ cytotoxic NK+T lymphocyte levels predict superior survival outcomes in patients with metastatic carcinoma. PMID: 23281059
  26. Low copy number of the Fc-gamma receptor 3B gene FCGR3B is a risk factor for primary Sjogren's syndrome. PMID: 22942264
  27. Studies indicate beta-defensins (DEFB4, DEFB103, DEFB104), chemokine ligand 3 like 1 (CCL3L1), Fc gamma receptor 3B (FCGR3B), and complement component C4 (C4) for copy number variation in disease association. PMID: 22837109
  28. The FcgammaRIIIB-SH allotype (CTGAAA) containing the 233A-allele (in bold) was associated with protection from malaria. The FcgammaRIIIB-NA2*03 allotype (CTGCGA), a variant of the classical FcgammaRIIIB-NA2 (CTGCAA) was associated with susceptibility to malaria. PMID: 23049979
  29. suggest that impaired immune complex clearance arising from FCGR3B deficiency contributes to the pathology of systemic sclerosis, and FCGR3B copy number variation is a common risk factor for systemic autoimmunity PMID: 22551723
  30. CD14++CD16+ monocytes independently predicted cardiovascular events in subjects referred for elective coronary angiography. PMID: 22999728
  31. Study indicates that a low copy number of the FCGR3B gene is associated with susceptibility to rheumatoid arthritis (RA). PMID: 22309893
  32. The FcgammaRIIIB-NA1 variant, which confers higher affinity for IgG than the NA2 variant, is a determining factor for treatment response. PMID: 22565545
  33. FCGR3B*1, FCGR3B*2 and FCGR3B*3 allele frequencies were respectively 0.347, 0.573 and 0.080 among Tunisians of sub-Saharan origin, 0.379, 0.591 and 0.030 among Tunisian blood donors and 0.318, 0.546 and 0.136 among the group from sub-Saharan Africa. PMID: 22512913
  34. Both ADAM10 and ADAM17 could shed CD16b, but they possess differed preferences. ADAM10 is the main sheddase under stimulation of ionomycin, while ADAM17 is the main sheddase under stimulation of PMA. PMID: 22770404
  35. NA2/NA2 and/or NA2 allele may be risk factors for generalized aggressive periodontitis in the population of South India PMID: 22167032
  36. In this Brazilian FCGR3B*03(+) group we found that the inheritance of FCGR3B*03 took place by a linkage to FCGR3B*02 or to FCGR3B*01. PMID: 21895673
  37. FCGR3B DNA copy number variation is associated with systemic lupus erythematosus risk in afro-caribbeans. PMID: 21296850
  38. Monocyte subsets have specialized roles during inflammation: CD16-positive monocytes might undergo an immediate innate immune response, whereas CD16-negative monocytes could have a major role as antigen presenting cells. PMID: 21937707
  39. Our results suggest that FcgammaRIIIb might not be a susceptibility gene for SLE and lupus nephritis. PMID: 20300756
  40. copy number associated with susceptibility to idiopathic pulmonary fibrosis PMID: 21109729
  41. IL-21 stimulates the production of IL-10 by CD4(+) T-cells. Secreted Il-10 maintains the expression of CD16 on monocytes. PMID: 21227406
  42. the neutrophil responses to stimuli that engage FcGR3B and FcGR2A, namely the phagocytosis of human IgG-opsonized zymosan and the responses to heat-aggregated IgGs PMID: 21123174
  43. FcgammaRIIIb NA1/2 polymorphisms are associated with idiopathic pulmonary fibrosis disease susceptibility but not with disease progression. PMID: 20924590
  44. study highlights the complexity and poor characterization of the FCGR3B gene sequence, indicating that the design and interpretation of genotyping assays based on specific probe sequences must be performed with caution PMID: 20957197
  45. The FCGR3B NA1/NA1 genotype was found in 75% of the patients with infusion reactions and in only 37% of those without (p=0.01), whereas the FCGR3A 176F/V genotype was equally distributed in the patients with or without infusion reactions. PMID: 20980704
  46. FcgammRIIA and FcgammaRIIIB are required for neutrophil mediated dermal epidermal separation in bullous pemphigoid PMID: 20720565
  47. results, obtained by fitting logistic regression models, confirm the association of low copy number of FCGR3B with systemic lupus erythematosus PMID: 20442749
  48. Results of the present study suggest that subjects carrying at least one copy of the FcgammaRIIIb-NA2 allele might be associated with susceptibility to aggressive periodontitis. PMID: 20041976
  49. The primary involvement of Fc gamma R IIIB NA2 allele is more likely involved with disease susceptibility of systemic lupus erythematosus. PMID: 20536598
  50. Significant evidence for an association between copy number and rheumatoid arthritis was observed in the Dutch cohort but not in the two smaller cohorts (New Zealand and United Kingdom populations, respectively). PMID: 20472591

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Note=Secreted after cleavage.
Tissue Specificity
Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils.
Database Links

HGNC: 3620

OMIM: 610665

KEGG: hsa:2215

STRING: 9606.ENSP00000294800

UniGene: Hs.372679

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*