Recombinant Human Luc7-like protein 3 (LUC7L3), partial

Code CSB-EP530965HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
LUC7L3
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
cAMP regulatory element-associated protein 1; Cisplatin resistance-associated overexpressed protein; Cisplatin resistance-associated-overexpressed protein; CRA; CRE-associated protein 1; CREAP-1; CREAP1 ; CROP; hLuc7A; LC7L3_HUMAN; LUC7 like 3 pre mRNA splicing factor; Luc7-like protein 3; Luc7A; LUC7L3; O48; OA48 18; Okadaic acid-inducible phosphoprotein OA48-18
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-79aa
Target Protein Sequence
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
13.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.
Gene References into Functions
  1. results indicate that LUC7L3, PPIG, and SFRS18 are not only implicated in EDA+ fibronectin formation, but also that they could possess multiple roles in psoriasis-associated molecular abnormalities. PMID: 28589370
  2. LUC7 like 3 pre-mRNA splicing factor (LUC7L3, also known as hLuc7A or CROP) is a novel interacting partner of HBV enhancer II and basal core promoter. PMID: 27857158
  3. these results show that angiotensin II and hypoxia, signals common to heart failure, result in increased LUC7L3 and RBM25 splicing regulators, increased binding of RBM25 to SCN5A mRNA, increased SCN5A splice variant abundances, decreased full-length SCN5A mRNA and protein, and decreased Na(+) current. PMID: 22939879
  4. RBM25/LUC7L3-mediated abnormal SCN5A mRNA splicing reduced Na+ channel current 91.1+/-9.3% to a range known to cause sudden death. PMID: 21859973
  5. These results suggest that cisplatin affects RNA splicing by changing the subnuclear distribution of proteins including cisplatin resistance-associated overexpressed protein (CROP). PMID: 12565863
  6. Luc7A is a new U1 snRNP-associated splicing factor. PMID: 17726058

Show More

Hide All

Subcellular Location
Nucleus speckle. Note=The subnuclear localization is affected by cisplatin.
Protein Families
Luc7 family
Tissue Specificity
Widely expressed. Highest levels in heart, brain, pancreas, thymus, ovary, small intestine and peripheral blood leukocytes, as well as cerebellum, putamen and pituitary gland. Lowest levels in lung, liver and kidney. Also expressed in fetal tissues, inclu
Database Links

HGNC: 24309

OMIM: 609434

KEGG: hsa:51747

STRING: 9606.ENSP00000240304

UniGene: Hs.130293

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*