Name: Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) (Active)
Brand: CUSABIO
SKU: CSB-YP013246HU
Price: $250 USD
Availability: InStock

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 2.816-3.741 ng/mL.

Target Names

LY6G6D

Uniprot No.

O95868

Research Area

Immunology

Alternative Names

(Protein Ly6-D)(Megakaryocyte-enhanced gene transcript 1 protein)

Molecular Characterization

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

20-104aa

Target Protein Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Mol. Weight

11.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

LY6G6D has emerged as a notable immunological target due to its selective expression on differentiated myeloid lineage cells, making it relevant to studies of tumor microenvironment biology and immune cell phenotyping. This recombinant human LY6G6D, covering the full-length mature protein (aa 20–104) with an N-terminal 6xHis tag, demonstrates robust binding activity validated by functional ELISA, where immobilized protein at 2 μg/mL bound anti-LY6G6D recombinant antibody with an EC50 of 2.816–3.741 ng/mL — a range that supports use in antibody characterization, sandwich ELISA development, and receptor-ligand interaction screening. Expressed in yeast to support eukaryotic folding of its Ly6/uPAR domain while minimizing mammalian-derived contaminants, this protein satisfies the purity and endotoxin criteria typical for cell-based functional assays, with greater than 95% purity by SDS-PAGE and endotoxin levels below 1.0 EU/μg. These attributes provide a suitable basis for generating positive assay controls and for use as an immunogen in antibody development campaigns.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Our questions are the following:
1)Both baculovirus and yeast expressed proteins are N-terminal His tagged. However we can only detect the His tag from the baculovirus expressed but not the yeast expressed. Were there any attempt try to remove the his tag?
2)My second question is that are these protein constructs designed as secretory soluble proteins? If so, what was the signal peptides used since the native signal peptides were removed?
3)Have there been any validation attempts to look at if the proteins are folded correctly, e.g. using LY6G6D antibodies? Was there any other product validation steps performed?

Thanks for your inquiry.
1. We haven't tried to remove the tag at present. CSB-YP013246HU indeed is N-terminal His tagged. We are also very surprised that you can not detect the tag.
2. Yes. These protein constructs designed as secretory soluble proteins, but we use the signal peptide that comes with the vectors. The vectors contain signal peptide restriction sites.
We're worry but we can't provide further information because info are confidential.
3. Eukaryotic expression has a post-translational modification which can be correctly folded in theory, but we haven't tested the protein structure yet.
For CSB-YP013246HU, we will test it using His-tag-antibody. It will take 3-5 working days to finish the experiment. We will share the result with you once we finish it.

Target Background

Gene References into Functions

Frequencies of the DRB1, DQA1, DQB1 and TNFA alleles in immigrant population of West Siberia PMID: 19807019

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Cell projection, filopodium.

Tissue Specificity

Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.

Database Links

HGNC: 13935

OMIM: 606038

KEGG: hsa:58530

STRING: 9606.ENSP00000364985

UniGene: Hs.591792

Code	CSB-YP013246HU
Abbreviation	Recombinant Human LY6G6D protein (Active)
MSDS	MSDS Datasheet
Size	$250
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC₅₀ is 2.816-3.741 ng/mL.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage