Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) (Active)

In Stock
Code CSB-YP013246HU
Abbreviation Recombinant Human LY6G6D protein (Active)
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 2.816-3.741 ng/mL.
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 2.816-3.741 ng/mL.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
(Protein Ly6-D)(Megakaryocyte-enhanced gene transcript 1 protein)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
20-104aa
Target Protein Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Mol. Weight
11.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Human LY6G6D recombinant protein was produced in Yeast, where the gene sequence encoding Human LY6G6D (20-104aa) was expressed with the N-terminal 6xHis tag. The purity of this LY6G6D protein was greater than 95%. The activity was validated.

LY6G6D gene encodes a protein of 133 amino acid residues with a molecular weight of 13.7 kDa and an isoelectric point of 6.56. The N-terminal 19 amino acid residues are the signal peptide, and the mature protein is composed of 85 amino acid residues. By bioinformatics analysis, the protein has a Ly-6/UPAR-like domain, which starts with leucine or isoleucine as the N-terminal and has 8-10 conserved cysteines. It is a member of the Ly-6 superfamily of glycosylphosphatidylinositol (GPI)-anchored cell surface proteins, and the 104th amino acid is the GPI anchoring site.
LY6G6D may be related to the occurrence of tumors, the characteristics of tumor stem cells, and the metastasis of tumor cells. However, the signaling pathways and mechanisms of LY6G6D in tumors need further research and exploration. It is expected that LY6G6D can be used as a potential new biological therapeutic target to provide new theoretical basis and methods for tumor treatment research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Our questions are the following:
1)Both baculovirus and yeast expressed proteins are N-terminal His tagged. However we can only detect the His tag from the baculovirus expressed but not the yeast expressed. Were there any attempt try to remove the his tag?
2)My second question is that are these protein constructs designed as secretory soluble proteins? If so, what was the signal peptides used since the native signal peptides were removed?
3)Have there been any validation attempts to look at if the proteins are folded correctly, e.g. using LY6G6D antibodies? Was there any other product validation steps performed?

A:
Thanks for your inquiry.
1. We haven't tried to remove the tag at present. CSB-YP013246HU indeed is N-terminal His tagged. We are also very surprised that you can not detect the tag.
2. Yes. These protein constructs designed as secretory soluble proteins, but we use the signal peptide that comes with the vectors. The vectors contain signal peptide restriction sites.
We're worry but we can't provide further information because info are confidential.
3. Eukaryotic expression has a post-translational modification which can be correctly folded in theory, but we haven't tested the protein structure yet.
For CSB-YP013246HU, we will test it using His-tag-antibody. It will take 3-5 working days to finish the experiment. We will share the result with you once we finish it.

Target Background

Gene References into Functions
  1. Frequencies of the DRB1, DQA1, DQB1 and TNFA alleles in immigrant population of West Siberia PMID: 19807019
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Cell projection, filopodium.
Tissue Specificity
Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
Database Links

HGNC: 13935

OMIM: 606038

KEGG: hsa:58530

STRING: 9606.ENSP00000364985

UniGene: Hs.591792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*