Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)

In Stock
Code CSB-YP013246HU
Size US$2010
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names LY6G6D
Uniprot No. O95868
Research Area Signal Transduction
Alternative Names Megakaryocyte-enhanced gene transcript 1 protein
Species Homo sapiens (Human)
Source Yeast
Expression Region 20-104aa
Target Protein Sequence NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 11.1kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

Our questions are the following:
1)Both baculovirus and yeast expressed proteins are N-terminal His tagged. However we can only detect the His tag from the baculovirus expressed but not the yeast expressed. Were there any attempt try to remove the his tag?
2)My second question is that are these protein constructs designed as secretory soluble proteins? If so, what was the signal peptides used since the native signal peptides were removed?
3)Have there been any validation attempts to look at if the proteins are folded correctly, e.g. using LY6G6D antibodies? Was there any other product validation steps performed?

A:
Thanks for your inquiry.
1. We haven't tried to remove the tag at present. CSB-YP013246HU indeed is N-terminal His tagged. We are also very surprised that you can not detect the tag.
2. Yes. These protein constructs designed as secretory soluble proteins, but we use the signal peptide that comes with the vectors. The vectors contain signal peptide restriction sites.
We're worry but we can't provide further information because info are confidential.
3. Eukaryotic expression has a post-translational modification which can be correctly folded in theory, but we haven't tested the protein structure yet.
For CSB-YP013246HU, we will test it using His-tag-antibody. It will take 3-5 working days to finish the experiment. We will share the result with you once we finish it.
 Customer Reviews

Target Data

Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor, Cell projection, filopodium
Tissue Specificity Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
Database Links

HGNC: 13935

OMIM: 606038

KEGG: hsa:58530

STRING: 9606.ENSP00000364985

UniGene: Hs.591792

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.