Recombinant Human Lymphocyte antigen 96 (LY96)

Code CSB-YP013254HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP013254HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP013254HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP013254HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
ESOP 1; ESOP-1; ESOP1 ; LY 96; Ly-96; LY96; LY96_HUMAN; Lymphocyte antigen 96; md 2; MD 2 protein; MD2 protein; Myeloid differentiation protein 2 ; Protein MD 2; Protein MD-2; Protein MD2
Species
Homo sapiens (Human)
Expression Region
17-160
Target Protein Sequence
EAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds bacterial lipopolysaccharide (LPS). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS.
Gene References into Functions
  1. sTLR4/MD-2 complex inhibits colorectal cancer migration and invasiveness in vitro and in vivo by lncRNA H19 down-regulation. PMID: 29036538
  2. MD-2 siRNA or plasmid further confirmed the efficacy of Iturin A by suppressing MD-2/TLR4 signaling pathway. The in silico docking study showed that the Iturin A interacted well with the MD-2 in MD-2/TLR4 receptor complex. Conclusively, inhibition of MD-2/TLR4 complex with Iturin A offered strategic advancement in cancer therapy. PMID: 28347875
  3. data confirm that engineered human cells expressing TLR4, MD2 and CD14 can respond to CMP with NF-kappaB activation and the response can be influenced by variations in CMP-mannosylation PMID: 29281684
  4. The observations suggest that MD-2 helps to regulate lipopolysaccharide-induced NLRP3 inflammasome activation and the inflammatory response in NR8383 cells, and likely does so by affecting MyD88/NF-kappaB signaling. PMID: 28654770
  5. MD2 plays an important role in induction of allergic sensitization to cat dander and common pollens relevant to human allergic diseases. PMID: 26586036
  6. we report that exogenous CnB is taken up by cells in a time- and concentration-dependent manner via clathrin-dependent receptor-mediated internalization. Our findings further confirm that uptake is mediated by the TLR4/MD2 complex together with the co-receptor CD14 PMID: 27090571
  7. In this study, a novel naturally occurring spliceosome of human MD2, termed as MD2-T3, has been identified. PMID: 27317890
  8. Results show that cigarette smoke may alter innate immune responses reducing the expression of the MD2, a molecule with an important role in TLR4 signaling. PMID: 26068048
  9. Predominantly hydrophobic interactions between MD-2 and TLR4 contribute to the stabilization of the TLR4/MD-2/metal ion complex in a conformation that enables activation. PMID: 25803856
  10. The intensity of the intra-amniotic inflammatory response to bacteria or perhaps to other TLR4 ligands may be facilitated through synthesis and release of sMD2 by the amniochorion. PMID: 25605324
  11. Three genes (LY96, IL8 DPR) were significantly downregulated over time. This finding was confirmed in a validation cohort of stroke patients (n=8). PMID: 25124890
  12. The study revealed the impact of specific residues and regions of MD-2 on the binding of lipolysaccharides and TLR4. PMID: 26320630
  13. Gene polymorphisms of MD2 and GM2A were associated with the occurrence or severity of neonatal necrotizing enterocolitis. PMID: 25816011
  14. In patients undergoing CABG surgery, we found genetic polymorphisms in LY96 associated with decreased risk of postoperative AF. PMID: 26385043
  15. Aminoarabinose residues in lipid A contribute to Burkholderia lipid A binding to the TLR4.Myeloid Differentiation Factor 2 complex. PMID: 26160169
  16. TLR4 along with its accessory protein MD-2 builds a heterodimeric complex that specifically recognizes lipopolysaccharides, which are present on the cell wall of gram-negative bacteria, activating the immune response. (Review) PMID: 25515751
  17. genetic polymorphism is associated with asthma exacerbations in children PMID: 24902762
  18. In monocytes of sepsis, MD-2 expression was found to be regulated by STAT1. PMID: 24858600
  19. Substitution of hMD-2 residue V82 with an amino acid residue with a bulkier hydrophobic side chain enables activation of TLR4/MD-2. PMID: 25203747
  20. This study suggests that genetic variants of LY96 may modulate the effect of smoking on carotid plaque burden. PMID: 24954085
  21. overexpression of MD-2s led to marked reduction in markers of tissue injury and inflammation in models of lung inflammation PMID: 25576596
  22. Purified monomeric ligand.MD-2 complexes reveal molecular and structural requirements for activation and antagonism of TLR4 by Gram-negative bacterial endotoxins. PMID: 24895101
  23. Studies suggest that myeloid differentiation 2 (MD-2) as a therapeutic target for sepsis. PMID: 24896325
  24. Mechanistically, engagement of MD-2 by PTX3-opsonized Aspergillus conidia activated the TLR4/Toll/IL-1R domain-containing adapter inducing IFN-beta-dependent signaling pathway converging on IL-10. PMID: 25049357
  25. Collectively, these data showed for the first time that, HIV-1 Tat interacts physically with high affinity with TLR4-MD2 to promote proinflammatory cytokines (TNF-alpha) and the immunosuppressive cytokine IL-10 both. PMID: 24165011
  26. Data suggest that zhankuic acid A (ZAA), which competes with LPS for binding to MD-2 as a TLR4/MD-2 antagonist, may be a potential therapeutic agent for gram-negative bacterial infections. PMID: 24532584
  27. these findings indicate that MD-2 is involved in IFN-gamma signalling and IFN-gamma-augmented MMP-1 up-regulation by LPS. PMID: 23800176
  28. Extracellular complex formation of TLR4 with secreted MD-2 was detectable using monoclonal antibodies. PMID: 24021278
  29. both oral and enteric C. concisus strains upregulated expression of TLR4 and MD-2 in HT-29 cells. PMID: 23437263
  30. Consistently, soluble TLR4 expressed without MD2 inhibited metal- but not LPS-induced responses, opening new therapeutic perspe PMID: 23059983
  31. Respiratory syncytial virus F protein requires MD-2 for the induction of the TLR4-mediated inflammatory response. PMID: 22872782
  32. In LOS.MD-2 complexes, one of the six fatty acyl chains of LOS is more susceptible to paramagnetic attenuation, suggesting protrusion of that fatty acyl chain from the hydrophobic pocket of MD-2, independent of association with TLR4. PMID: 22433852
  33. Lipopolysaccharide cytokine response was efficiently and equally abolished by MD-2 and CD14 neutralization; the response induced by whole E. coli bacteria was only modestly reduced by MD-2 neutralization, whereas CD14 neutralization was more efficient. PMID: 21948372
  34. have identified specific structural and dynamic features of the MD-2-endotoxin complexes that may control dimerization of TLR4 molecules. PMID: 21924775
  35. The association between occupational endotoxin exposure and wheeze in agricultural workers was significantly modified by genetic variants in CD14 and MD2 PMID: 21389010
  36. Data demonstrate that during bacterial infection, newborns amplify the TLR2-MyD88 pathway in G+ bacterial infection and the TLR4/MD2/MyD88 pathway in G- bacterial infection, implicating the innate immune pathway in response to bacterial infection. PMID: 20805788
  37. higher expression levels in tissue from patients with colorectal cancer PMID: 20699280
  38. Computational study of the interactions of the unmodified dendrimer, glucosamine, and of the partially glycosylated dendrimer with TLR4 and MD-2 using molecular docking and molecular dynamics techniques. PMID: 21738462
  39. tyrosine phosphorylation of MD-2 is important for signaling following exposure to lipopolysaccharide PMID: 21918188
  40. Cytokines can enhance TLR4 and MD-2 expressions and promote the reaction with LPS in intestinal epithelial cells. PMID: 20848773
  41. Interferon-gamma-induced MD-2 protein expression and lipopolysaccharide (LPS) responsiveness in corneal epithelial cells is mediated by Janus tyrosine kinase-2 activation and direct binding of STAT1 protein to the MD-2 promoter. PMID: 21572044
  42. In this study, we produced variants of MD-1 and MD-2 in Pichia pastoris. PMID: 21130168
  43. Innate immune recognition of meningococcal capsular polysaccharides by macrophages can occur via TLR2- and TLR4-MD-2 pathways. PMID: 21191086
  44. Neisserial lipooligosaccharides from different meningococcal and gonococcal strains have different potencies to activate NF-kappaappaB through the Toll-like receptor 4-MD-2 pathway in monocytes. PMID: 21037101
  45. Data conclude that these gene variants in the MD-2 gene promoter region are not associated with tuberculosis, and apparently do not play a role in susceptibility to tuberculosis in the Chinese population. PMID: 20730709
  46. species-specific activation of lipid IV(A) PMID: 20592019
  47. increased expression in intestinal epithelial cells in patients with inflammatory bowel disease PMID: 19710105
  48. In this study, we have identified a novel alternatively spliced isoform of human MD-2, termed MD-2 short (MD-2s), which lacks the region encoded by exon 2 of the MD-2 gene. PMID: 20435923
  49. Polymorphisms of the promoter region of MD-2 gene at position - 1625 C/G is correlated with MODS and sepsis after severe trauma in Chinese Han population. PMID: 19209789
  50. sMD-2 and sCD14 inhibit the growth of both Gram-positive and Gram-negative bacteria. PMID: 20377740

Show More

Hide All

Subcellular Location
Secreted, extracellular space. Secreted.
Database Links

HGNC: 17156

OMIM: 605243

KEGG: hsa:23643

STRING: 9606.ENSP00000284818

UniGene: Hs.726603

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1