Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PBK

Uniprot No.

Q96KB5

Research Area

Cell Biology

Alternative Names

Cancer/testis antigen 84; CT84; Epididymis luminal protein 164; FLJ14385; HEL164; Lymphokine activated killer T cell originated protein kinase; Lymphokine-activated killer T-cell-originated protein kinase; MAPKK like protein kinase; MAPKK-like protein kinase; Nori 3; Nori-3; Nori3; PBK; PDZ binding kinase; PDZ-binding kinase; Serine/threonine protein kinase; Spermatogenesis related protein kinase; Spermatogenesis-related protein kinase; SPK; T LAK cell originated protein kinase; T-LAK cell-originated protein kinase; TOPK; TOPK_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-322aa

Target Protein Sequence

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

63.1kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Constructing a plasmid that codes for the Human PBK protein (1-322aa) is the initial step to yield the recombinant Human PBK protein. The plasmid is then transferred into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. A N-terminal GST tag is fused to the protein. The affinity purification is used to purify the protein, and SDS-PAGE analysis is carried out to verify the presence and assess the purity of the protein. The protein possesses a purity exceeding 90%.

Target Background

Function

Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.

Gene References into Functions

Results found that PBK/TOPK was upregulated and phosphorylated in HTLV1-transformed Tcell lines and ATLLderived Tcell lines. In addition, HTLV1 infection upregulated PBK/TOPK expression in PBMCs, suggesting that this kinase increases the rate of mitosis and expands malignant T cells. PMID: 29901068
Findings strongly suggest that phosphorylated T-lymphokine-activated killer cell-originated protein kinase may be a potent biomarker to determine the outcome of patients with primary central nervous system lymphoma and to develop novel drugs to treat primary central nervous system lymphoma. PMID: 29575092
the expression of TOPK be a novel alternative biomarker to categorize the malignancy of gliomas. PMID: 29271010
CDK1-mediated mitotic phosphorylation of PDZ-binding kinase is involved in cytokinesis and inhibits its oncogenic activity. PMID: 28780319
Data suggest that T-LAK cell-originated protein kinase (TOPK) might play a pivotal role in breast cancer invasion and metastasis. PMID: 28212583
our study provide convincing evidences that FoxM1-regulated PBK exerts oncogenic activities towards HCC via the activation of beta-Catenin pathway. PMID: 28525379
High TOPK expression is associated with liver cancer. PMID: 27582549
The role of T-LAK cell-originated protein kinase directly promotes metastasis of colorectal cancer by modulating p53-related protein kinase. PMID: 28412249
TOPK protein and transcriptional levels of FOXM1 were reduced by TOPK inhibitor treatment. PMID: 27334838
Results indicate that src-family kinase (Src) is a upstream kinase of T-LAK cell-originated protein kinase (TOPK). PMID: 27016416
Upregulation of proteasome subunit beta type 8 PSMB8 and PDZ binding kinase PBK was confirmed by real-time reverse transcription-PCR analysis. PMID: 26894977
MiR-770-5p and PBK levels were inversely correlated in xenograft model mice. PMID: 28333152
TOPK knockdown did not alter radiation response in normal tissues, but significantly enhanced radiosensitivity in cancer cells.These findings have clinical relevance, as elevated TOPK protein expression was associated with poorer clinical outcomes in prostate cancer patients treated with radical radiotherapy. TOPK disruption may cause tumour-specific radiosensitisation in multiple different tumour types. PMID: 28677687
Determined the crystal structure of PBK, which has two phospho-mimicking mutations T9E and T198E. The structural data indicated that PBK may assemble into an inactive dimer in alkaline conditions. Analytical size-exclusion chromatography and analytical ultracentrifugation confirmed that PBK exists in a conformational transition between dimers and monomers at different pH conditions. PMID: 27262437
PBK/TOPK plays a crucial role in tumour malignant potential through its overexpression and highlight its usefulness as a prognostic factor and potential therapeutic target in gastric cancer. PMID: 27898655
A high PBK expression level was correlated with long overall survival in oral squamous cell carcinoma. PMID: 27347940
findings suggest that PBK/TOPK plays a crucial role in tumor malignant potential through its overexpression in ESCC PMID: 27919968
TOPK silencing sensitizes EGFR-TKI-resistant lung cancer cells to gefitinib and increases gefitinib efficacy in preclinical lung adenocarcinoma xenograft models. PMID: 26745678
Study shows that BUB1beta and PDZ binding kinase are up-regulated in breast cancer tumors and their expression is associated with improved overall survival (OS) in basal-like tumors but worse OS in luminal and untreated patients. PMID: 26897635
Overexpression of Nrf2 inhibited the PBK/TOPK KD-induced decrease in cdc2 and cyclin B expression and cell cycle arrest, and blocked ROS production and apoptosis. PMID: 26503118
The in vitro data have been consistent with a role for PBK/TOPK in facilitating invasion in prostate cancer. PBK could be a prognostic biomarker for prostate cancer that would discriminate aggressive prostate cancer from indolent disease. PMID: 25909225
TOPK was speculated to be one of a potential marker and therapeutic target in advanced prostate cancer PMID: 25881543
Authors identified TOPK/PBK, in vitro and in vivo, as the master ZFP linker kinase. Furthermore, they show precise temporal correlation between TOPK activating phosphorylation by Cdk1 and linker phosphorylation in mitosis. PMID: 25575812
PBK/TOPK expression is closely associated with cervical cancer and cervical intraepithelial neoplasia, which may be served as a useful target for tumor diagnosis and immunotherapy. PMID: 25550851
TOPK, overexpressed in colorectal cancer, enhances the resistance of colorectal cancer cells to anoikis. PMID: 25687885
PDZ-binding kinase/T-LAK cell-originated protein kinase correlates with mutant p53 and affects cell proliferation and viability as well as prognosis in lung adenocarcinoma PMID: 25466965
Study findings suggest that the PBK/TOPK mRNA/protein expression is specific to human bladder cancer and might be used as a novel target for development of cancer immunotherapy and diagnostic biomarker. PMID: 24629784
TOPK protein upregulates iNOS gene expression in T cell leukemia Jurkat cells or macrophage leukemic Raw 264.7 cells via NF-kappaB activation in response to LPS, and might act as a critical effector in LPS/TLR4-mediated signaling cascade. PMID: 24440499
PBK/TOPK expression is positively correlated with Ki67 and p53 expression, and can be used as an independent prognostic factor in non-small-cell lung cancer. PMID: 24025073
These results suggest that the malignant transformation of plexiform neurofibroma is associated with distinct changes in the expression of BUB1B, PBK and NEK2 PMID: 23370767
The 3D structure of TOPK protein has been constructed by using multiple templates. PMID: 22940854
that the serine-threonine kinase PBK/TOPK is frequently overexpressed in high-grade lymphomas and its expression is positively correlated to that of c-Myc and E2F1 PMID: 23237560
TOPK directly interacted with and phosphorylated IkappaBalpha at Ser-32, leading to p65 nuclear translocation and NF-kappaB activation. PMID: 23250755
Our results indicate that overexpression of TOPK could predetermine the metastatic capability of tumors and could serve as a significant prognostic predictor of shortened overall survival and time to recurrence. PMID: 22192142
T-LAK cell-originated protein kinase (TOPK) phosphorylation of MKP1 protein prevents solar ultraviolet light-induced inflammation through inhibition of the p38 protein signaling pathway. PMID: 21715333
Upregulation of TOPK is associated with breast cancer. PMID: 20589935
increased levels of PBK/TOPK may contribute to tumor cell development and progression through suppression of p53 function and consequent reductions in the cell-cycle regulatory proteins such as p21. PMID: 20622899
Phosphorylation of Prx1 (Ser-32) by TOPK prevents UVB-induced apoptosis in RPMI7951 melanoma cells through regulation of Prx1 peroxidase activity and blockade of intracellular H(2)O(2) accumulation. PMID: 20647304
TOPK is indispensable for cancer cell cytokinesis throughout phosphorylation on p97. PMID: 19900192
PBK/TOPK protein could serve as a useful indicator for histopathologic differentiation between cholangiocarcinoma and hepatocellular carcinomas and the low expression of PBK/TOPK is predicative of poor survival in cholangiocarcinoma patients. PMID: 19954816
PBK/TOPK is upregulated in Burkitt's lymphoma and other highly proliferative malignant cells and during normal fetal development. PMID: 11783945
TOPK protein is up-regulated in a variety of hematologic malignancies and may be involved in leukemic cell growth; 4 of 5 clinical that strongly expressed TOPK also strongly expressed phosphorylated c-Myc PMID: 14757441
PBK/TOPK plays an important role in transiently amplifying neural progenitors in the adult subependymal zone of transgenically targeted mice. PMID: 16291951
PBK augments tumor cell growth following transient appearance in different types of progenitor cells in vivo as reported. PMID: 17482142
Findings showed that TOPK positively modulated UVB-induced JNK1 activity and played a pivotal role in JNK1-mediated cell transformation induced by H-Ras. PMID: 17545598
The positive feedback loop between TOPK and ERK2 increases tumorigenesis properties of HCT116 colorectal cancer cells, and TOPK-regulated signaling may serve as a potential therapeutic target in colorectal cancer PMID: 17631144

Hide All

Protein Families

Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily

Tissue Specificity

Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.

Database Links

HGNC: 18282

OMIM: 611210

KEGG: hsa:55872

STRING: 9606.ENSP00000301905

UniGene: Hs.104741

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP822241HU
Abbreviation	Recombinant Human PBK protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Lymphokine-activated killer T-cell-originated protein kinase (PBK)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage