Recombinant Human MOB kinase activator 1A (MOB1A)

Code CSB-EP872519HU
Abbreviation Recombinant Human MOB1A protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
B1; Mps One Binder kinase activator like 1B (yeast); C2orf6 ; Chromosome 2 open reading frame 6; FLJ10788; FLJ11595; MATS1 ; MOB kinase activator 1A; MOB1 ; Mob1 alpha; Mob1 homolog 1B; MOB1 Mps One Binder homolog A; MOB1 Mps One Binder kinase activator like 1B; Mob1A; MOB4B ; Mob4B protein; MOBK1B; Mobkl1b; MOL1B_HUMAN; Mps one binder kinase activator like 1B; Mps one binder kinase activator-like 1B; Protein Mob4B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-216aa
Target Protein Sequence
SFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38 and STK38L. Acts cooperatively with STK3/MST2 to activate STK38.
Gene References into Functions
  1. validated the functional importance of an identified interaction network by characterizing a distinct novel interaction between PTPN5 and Mob1a. PMID: 28675297
  2. Through a comprehensive set of biochemical, biophysical, mutational and structural studies, we quantitatively assess how phosphorylation of MOB1A regulates its interaction with both MST kinases and LATS/NDR family kinases in vitro. PMID: 28373297
  3. In this study, we investigated the mechanisms behind the recruitment of MST1 and MST2 kinases to MOB1, which facilitate signal transmission in the Hippo pathway by bringing the MST1 and MST2 kinases in close vicinity to their substrates, the LATS family kinases. PMID: 28373298
  4. MOB1 binds differently to the NDR2 and LATS1 kinases.MOB1 interaction with Hippo and MST protein is not essential for development and tissue growth control. PMID: 28947795
  5. No relationship has been found between the MOBKL1B-NS5A interaction and hepatitis C virus replication. PMID: 25031347
  6. The RING ligase praja2 ubiquitylates and degrades Mob, a core component of NDR/LATS kinase and a positive regulator of the tumour-suppressor Hippo cascade. PMID: 23652010
  7. Mob1A and Mob1B are needed for cell abscission and centriole re-joining after telophase and cytokinesis. PMID: 22454515
  8. Results suggest that Mob1 and the other mammalian orthologues of the mitotic exit network regulate mitotic progression by facilitating the timely mobilization of the chromosomal passenger complex to the spindle midzone. PMID: 19955215
  9. hMOB1A and hMOB1B are 2 LATS-binding proteins that may function as tumor suppressors in human cancer cells. PMID: 19739119
  10. Mats1 can rescue the lethality associated with loss of Mats function in Drosophila; As Mats1 is mutated in human tumors, Mats-mediated growth inhibition and tumor suppression is likely conserved in humans PMID: 15766530
  11. MATS1 mRNA expression is suppressed in tumor tissue and its low expression is associated with tumor growth, invasion and metastasis of colorectal cancer PMID: 17611689

Show More

Hide All

Protein Families
MOB1/phocein family
Tissue Specificity
Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver.
Database Links

HGNC: 16015

OMIM: 609281

KEGG: hsa:55233

STRING: 9606.ENSP00000379364

UniGene: Hs.602092

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*