Recombinant Human Mitochondrial import receptor subunit TOM34 (TOMM34)

Code CSB-EP623014HU
Abbreviation Recombinant Human TOMM34 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TOMM34
Uniprot No.
Research Area
Signal Transduction
Alternative Names
hTom34; HTOM34P; Mitochondrial import receptor subunit TOM34; OTTHUMP00000031079; Outer mitochondrial membrane translocase (34kD); TOM 34; TOM34; TOM34_HUMAN; TOMM 34; TOMM34; Translocase of outer membrane 34 kDa subunit; Translocase of outer mitochondrial membrane 34; URCC 3; URCC3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-309aa
Target Protein Sequence
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
61.6kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state.
Gene References into Functions
  1. Data show that Tomm34 extensively interacts with the C-terminal structures of Hsp70 selectively in its ATP-bound state and that this interaction is strongly entropically driven. PMID: 26944342
  2. These results suggest that Tomm34 represents a novel scaffolding co-chaperone of Hsp70 and Hsp90, which may facilitate Hsp70/Hsp90 cooperation during protein folding PMID: 24567332
  3. TOMM34 expression in early invasive breast cancer: a biomarker associated with poor outcome. PMID: 23053644
  4. Results identify Tom34 as a cochaperone of Hsp70/Hsp90 in mitochondrial protein import. PMID: 22178133
  5. Tom34 unlike Tom20 does not interact with the leader sequences of mitochondrial precursor proteins PMID: 11913975
  6. Yeast two-hybrid screening identifies binding partners of human Tom34 that have ATPase activity and form a complex with Tom34 in the cytosol PMID: 11913976
  7. TOMM34 is involved in the growth of colon cancer cells PMID: 16820880
  8. Data show that NRF-1 is the main transcription factor regulating the expression of TOMM34, and that Sp1 interacts with NRF-1 to stimulate the promoter's full activity. PMID: 18364745

Show More

Hide All

Subcellular Location
Cytoplasm. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Tom34 family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 15746

OMIM: 616049

KEGG: hsa:10953

STRING: 9606.ENSP00000361900

UniGene: Hs.517066

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*