Recombinant Human Mucin-13 (MUC13), partial

Code CSB-MP887973HU1
Abbreviation Recombinant Human MUC13 protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
MUC-13;Down-regulated in colon cancer 1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
322-421aa
Target Protein Sequence
LTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.6 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Epithelial and hemopoietic transmembrane mucin that may play a role in cell signaling.
Gene References into Functions
  1. The results suggest that MUC13 overexpression and loss of expression of AGR2 may predict the progression of Intraductal papillary mucinous neoplasm and an unfavorable prognosis in patients with Intraductal papillary mucinous neoplasm PMID: 29650332
  2. our study first demonstrated that USF1 could activate the transcription of MUC13, thereby enhancing the proliferation and self-renewal of glioblastoma stem cells PMID: 29441861
  3. MUC13 high expression is a novel independent adverse prognostic factor of clinical outcome in non-metastatic clear cell renal cell carcinoma patients after surgery. PMID: 27911274
  4. Luciferase assays and western blot confirmed MUC13 as a target gene of miR1323p. PMID: 28339011
  5. Results from this study demonstrate that MUC13 Functionally interacts and activates HER2 at p1248 in PDAC cells, leading to stimulation of HER2 signaling cascade, including ERK1/2, FAK, AKT and PAK1 as well as regulation of the growth, cytoskeleton remodeling and motility, invasion of PDAC cells-all collectively contributing to PDAC progression. PMID: 27321183
  6. High MUC13 expression is associated with renal cell carcinoma and drug resistance. PMID: 28205224
  7. A combination of MUC13/MUC20 expression was a potential prognostic marker for patients with ESCC, who received neoadjuvant chemotherapy followed by surgery. PMID: 26323930
  8. Results show that pancreatic ductal adenocarcinoma cells express higher levels of MUC13 and is associated with poor outcome when expressed at low level. PMID: 25672256
  9. Based on nasopharyngeal MUC13 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants. PMID: 25261323
  10. These results suggest miR-145 as a novel regulator of MUC13 in pancreatic cancer. PMID: 25277192
  11. Overexpression of MUC13 increased cell growth, colony formation, cell migration, and invasion in colon cancer cells. PMID: 24097071
  12. MUC13 is epigenetically regulated in ovarian cancer. PMID: 25048476
  13. Overexpression of MUC13 is associated with pancreatic neuroendocrine tumors. PMID: 24114056
  14. GALNT14 may contribute to ovarian carcinogenesis through aberrant glycosylation of MUC13. PMID: 23708057
  15. Metastatic colon cancer and liver metastasis tissue samples demonstrated significantly (p<0.05) higher cytoplasmic and nuclear MUC13 expression compared with non-metastatic colon cancer and adjacent normal colon samples. PMID: 22914648
  16. MUC13 overexpression caused a significant increase in cell motility, invasion, proliferation, and anchorage-dependent or -independent clonogenicity while decreasing cell-cell and cell-substratum adhesion in pancreatic cancer. PMID: 22027689
  17. The various functional domains of MUC13 may confer oncogenic potential to MUC13 PMID: 21450906
  18. MUC13 is a good differentiation marker for gastrointestinal mucosa PMID: 15904467
  19. Aberrant intestinal expression and allelic variant MUC13 is associated with inflammatory bowel disease. PMID: 17058067
  20. Reflux laryngitis is associated with down-regulation of mucin gene expression. PMID: 18834073
  21. Findings show the aberrant expression of MUC13 in ovarian cancer and that its expression alters the cellular characteristics of SKOV-3 cells. This implies a significant role of MUC13 in ovarian cancer. PMID: 19176398

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Apical cell membrane. Secreted. Note=Also exists as a soluble form.
Tissue Specificity
Highly expressed in epithelial tissues, particularly those of the gastrointestinal and respiratory tracts, such as large intestine and trachea, followed by kidney, small intestine, appendix and stomach.
Database Links

HGNC: 7511

OMIM: 612181

KEGG: hsa:56667

STRING: 9606.ENSP00000312235

UniGene: Hs.5940

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*