Recombinant Human Mucin-2(MUC2),partial

Code CSB-YP015222HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. Q02817
Relevance Coats the epithelia of the intestines, airways, and other mucus mbrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Intestinal mucin-2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Research Area Signal Transduction
Source Yeast
Gene Names MUC2
Protein Names Recommended name: Mucin-2 Short name= MUC-2Alternative name(s): Intestinal mucin-2
Expression Region 36-240aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 24.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Subcellular Location Secreted
Tissue Specificity Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.
Database Links

HGNC: 7512

OMIM: 158370

STRING: 9606.ENSP00000415183

UniGene: Hs.315

Related Products

MUC2 Antibodies

MUC2 Antibodies for Homo sapiens (Human)

MUC2 Proteins

MUC2 Proteins for Homo sapiens (Human)

MUC2 ELISA Kit

MUC2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.