Recombinant Human Myc proto-oncogene protein(MYC),partial

Code CSB-EP015270HU1
Product Type Recombinant Protein
Size US$1726
Uniprot No. P01106
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names MYC
Expression Region 184-454aa
Tag Info N-terminal 6xHis-GST-tagged
Mol. Weight 61.7 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis
Involvement in disease Burkitt lymphoma (BL)
Subcellular Location Nucleus, nucleoplasm, Nucleus, nucleolus
Database Links

HGNC: 7553

OMIM: 113970

KEGG: hsa:4609

STRING: 9606.ENSP00000367207

UniGene: Hs.202453

Pathway ErbB signaling pathway
Hippo signaling pathway
Jak-STAT signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Wnt signaling pathway
Cell cycle
Cellular senescence
Signaling pathways regulating pluripotency of stem cells

Related Products

MYC Antibodies

MYC Antibodies for Homo sapiens (Human)

MYC Antibodies for Human

MYC Proteins

MYC Proteins for Homo sapiens (Human)

MYC ELISA Kit

MYC ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.