Recombinant Human NKG2-C type II integral membrane protein(KLRC2),partial

Code CSB-EP012467HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names KLRC2
Uniprot No. P26717
Research Area Immunology
Alternative Names CD antigen CD159c; CD159 antigen like family member C; CD159 antigen-like family member C; CD159c; Killer cell lectin like receptor subfamily C, member 2; KLRC2; NK cell receptor C; NKG2-C type II integral membrane protein; NKG2-C-activating NK receptor; NKG2C activating NK receptor; NKG2C; NKG2C_HUMAN
Species Homo sapiens (Human)
Source E.coli
Expression Region 94-231aa
Target Protein Sequence IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 31.8kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Gene References into Functions
  1. a 16kb deletion encompassing the NKG2C gene is associated with lower carotid intimal media thickness values and higher humoral and T-cell responses to cytomegalovirus in renal transplant recipients PMID: 28987961
  2. the data of this study extend the characterization of adaptive NK cell subsets that differentiate in response to human Cytomegalovirus, supporting a relationship between their distribution and NKG2C copy number PMID: 26994220
  3. The new method offers the potential to use SNP arrays from genome wide association studies to study the frequency of KLRC2 deletion in other populations and its association with other diseases PMID: 27312142
  4. Assessment of NK cell repertoires in 60 NKG2C(-/-) donors revealed a broad range of NK cell populations displaying characteristic footprints of adaptive NK cells, including a terminally differentiated phenotype, functional reprogramming, and epigenetic remodeling of the interferon (IFN)-gamma promoter. PMID: 27117418
  5. HLA-E regulates NKG2C+ natural killer cell function through presentation of a restricted peptide repertoire PMID: 26382247
  6. genetic polymorphism is not associated with nasopharyngeal carcinoma in China PMID: 25636564
  7. Data suggest the proinflammatory potential of NKG2C(bright) NK cells. PMID: 25667418
  8. lack of expression of NKG2C may be associated with altered control of human cytomegalovirus infection in childhood PMID: 25150297
  9. No difference in the prevalence of NKG2C deletion was observed. PMID: 24305414
  10. NKG2C receptor deletion and a functional polymorphism in its ligand HLA-E may play a role in psoriasis susceptibility PMID: 24079744
  11. NKG2C(hi)CD57+ NK cells respond specifically to acute infection with cytomegalovirus and not Epstein-Barr virus. PMID: 24740502
  12. NKG2Cnull does not seem to constitute a risk factor for HPV-induced cervical lesions. PMID: 23911737
  13. NKG2C zygosity influences CD94/NKG2C receptor function and the NK-cell compartment redistribution in response to human cytomegalovirus. PMID: 24030638
  14. coexpression of killer cell Ig-like receptor (KIR) and NKG2C on expanded NK cell subsets could be related to a functional contribution of KIR in cytomegalovirus infection PMID: 23918974
  15. NKG2Chi CD57hi natural killer cells are highly responsive to human cytomegalovirus-infected macrophages only in the presence of HCMV-specific antibodies, whereas they are functionally poor effectors of natural cytotoxicity. PMID: 23637420
  16. The increased expression of NKG2C in HIV patients indicate that NKG2C is important in the defense against HIV infection and progression. PMID: 22074011
  17. A significantly elevated proportion of ex vivo peripheral blood CD4 T cells, but not CD8 T cells or natural killer (NK) cells, from multiple sclerosis patients express NKG2C, which contributes to tissue injury. PMID: 23396942
  18. HCMV-infected NKG2C(+/+) children displayed higher absolute numbers of NKG2A(+) and total NK cells than NKG2C(+/-) individuals. PMID: 22965785
  19. expression by Vdelta2+ T cells is lower in pregnant women PMID: 19395088
  20. CD94/NKG2C might be involved in triggering cytotoxic lymphocytes in patients with Toxic epidermal necrolysis and Stevens-Johnson syndrome PMID: 20132973
  21. Common occurrence of NKG2-C gene deletion in the general population. PMID: 12618865
  22. NKG2C is not essential for survival and reproduction, and is not associated with rheumatic diseases PMID: 14688071
  23. strict gene regulatory mechanisms for CD94 and NKG2 gene expression on CD4+ cells PMID: 15550116
  24. CD94/NKG2C may constitute an alternative T cell activation pathway capable of driving the expansion and triggering the effector functions of a cytotoxic T cell subset. PMID: 15940674

Show More

Hide All

Subcellular Location Membrane, Single-pass type II membrane protein
Tissue Specificity Natural killer cells.
Database Links

HGNC: 6375

OMIM: 602891

KEGG: hsa:3822

STRING: 9606.ENSP00000371327

UniGene: Hs.591157

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1