Recombinant Human Neurotrophin-4 (NTF4)

In Stock
Code CSB-EP016121HU
Abbreviation Recombinant Human NTF4 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
NT-4;Neurotrophin-5;NT-5;Neutrophic factor 4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
81-210aa
Target Protein Sequence
GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Target-derived survival factor for peripheral sensory sympathetic neurons.
Gene References into Functions
  1. Elevated intra-amniotic levels of docosahexaenoic acid and arachidonic acid in the mid-trimester are correlated with increased NT4 concentrations. PMID: 24607879
  2. The NTF4 variants p.Gly157Ala and p.Ala182Val have been shown to be functional mutations, occurring in 2 of a total of 720 Chinese primary open-angle glaucoma patients. PMID: 22815630
  3. NT-4/5 expression is associated with atrophy of the brain-parenchymal fraction measured by magnetic resonance imaging methods in patients with relapsing-remitting multiple sclerosis. PMID: 22036954
  4. Suggest that a dysregulated TrkB/NT4/5 axis may contribute to several of the pathological lesions associated with pulmonary fibrosis, including type 2 alveolar cell hyperplasia and the proliferation of fibroblasts. PMID: 21330466
  5. neurotrophin 4 contributes to breast cancer cell survival and can serve as prospective target to inhibit tumor growth PMID: 21350004
  6. In vitro follicular assembly is significantly increased in fetal ovaries cultured with NT-4. PMID: 20447632
  7. Identification of a single mutation in our study suggests that NTF4 mutations are a rare cause of primary open-angle glaucoma (0.6%, 95%CI 0.02%-3.16%) in Chinese people. PMID: 20806036
  8. present data indicate a lack of involvement of variations in NTF4, VAV2, and VAV3 with glaucoma pathogenesis in an Indian population. PMID: 20463313
  9. Expression of human NTF4 was unchanged during gestation in the developping ovary. PMID: 20175187
  10. No evidence of association of heterozygous NTF4 mutations in patients with primary open-angle glaucoma. PMID: 20215012
  11. A mechanism to understand the defect associated with variant BDNF and provide a framework two ligands for BDNF and NT-4. PMID: 15987945
  12. Re-expression of the p75NTR appears to partially reverse de-differentiation of prostate cancer cells by up-regulating the expression of CRABPI for localized sequestration of retinoids. PMID: 16316409
  13. Results revealed the expression of NT-4/5 mainly in oocytes and, in a minority of samples, also in the granulosa cells (GCs). PMID: 16648150
  14. These novel data demonstrate that neurotrophins influence ASM [Ca(2+)](i) and force regulation and suggest a potential role for neurotrophins in airway diseases PMID: 16648236
  15. Neurotrophin 4/5 plays a role in the proliferation and differentiation of periodontal ligament cells. PMID: 18980528
  16. Data show that the levels of NT-4/5 levels are significantly higher in bipolar disorder patients than in controlsNT-4/5. immunocontent alterations in bipolar disorder. PMID: 19081579
  17. NTF4 mutations impair neurotrophin-4 signaling in patients with primary open-angle glaucoma and lead to decreased activation of TrkB PMID: 19765683

Show More

Hide All

Involvement in disease
Glaucoma 1, open angle, O (GLC1O)
Subcellular Location
Secreted.
Protein Families
NGF-beta family
Tissue Specificity
Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.
Database Links

HGNC: 8024

OMIM: 162662

KEGG: hsa:4909

STRING: 9606.ENSP00000301411

UniGene: Hs.266902

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*