Recombinant Human Neutrophil collagenase (MMP8)

In Stock
Code CSB-EP014678HU
Abbreviation Recombinant Human MMP8 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
101-467aa
Target Protein Sequence
LTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Can degrade fibrillar type I, II, and III collagens.
Gene References into Functions
  1. The meta-analysis results showed a remarkable association between rs11225394 in MMP-8 gene and an increased risk of osteonecrosis of the femoral head and a significant association between MMP-8 rs2012390 and the decreased risk of osteonecrosis of the femoral head. PMID: 30313082
  2. Results suggest that MMP8 C-799T, Val436Ala and Lys460Thr may only play an indirect role in determining personal cancer susceptibility for bladder cancer in Taiwan. PMID: 30194163
  3. Low MMP8 level is associated with gastric cancer. PMID: 30192205
  4. Five single nucleotide polymorphisms including rs3740938, rs2012390, rs1940475, rs11225394, and rs11225395 of MMP-8 gene were genotyped in a Chinese Han population. It was found rs3740938 of MMP-8 was associated with an increased risk of ankylosing spondylitis under the dominant model and additive model after adjustment for gender and age by performing logistic regression analysis. PMID: 30170451
  5. Data show that polymorphism in the promoter region of matrix metallopeptidase 8 (MMP-8) (-799C/T) and two non-synonymous polymorphisms (Val436Ala and Lys460Thr) were not significantly associated with risk of pterygium.pterygium. PMID: 29275297
  6. Persistent oral human papillomavirus infection was associated with a low salivary MMP-8 concentration indicating eventually a failure in oral anti-inflammatory defence. PMID: 29078079
  7. Genetic polymorphism in S100A9-S100A12-S100A8 locus affects serum and plasma MMP-8 and shows a suggestive association with the risk of cardiovascular diseases. PMID: 29212897
  8. Our study demonstrated that the MMP-8 C-799T is associated with the risk of developing severe preeclampsia during pregnancy. However, the MMP-8 C + 17G polymorphism might not be a risk factor for susceptibility to preeclampsia. PMID: 28745526
  9. Our findings suggest that the polymorphisms at MMP-8 -799C/T, Val436Ala and Lys460Thr may not play a major role in determining the personal susceptibility to childhood acute lymphoblastic leukemia in Taiwan. PMID: 29102926
  10. Reduction in serum levels of MMP8 predicted complete remission in type 2 diabetes mellitus patients following bariatric surgery. PMID: 28734574
  11. MMP8 -799C/T, Val436Ala and Lys460Thr polymorphisms may only play an indirect role in determining personal cancer susceptibility to breast cancer in Taiwan. PMID: 29599337
  12. Our findings suggest that the polymorphisms at MMP-8 C-799T or Val436Ala may not play a major role in mediating personal risk of oral cancer; however, the detailed mechanisms require further investigation. PMID: 28652424
  13. Suggest that Ang-(1-7) plays an important role in protecting against atherosclerosis via counter-regulation of Ang II-induced MMP-8. PMID: 28283184
  14. Data show that individuals with MMP-8 -799TT genotype and intermediate HIV disease stage are at higher risk for the advancement of HIV disease. MMP-8 polymorphism indicated a trend of elevated risk for the modulation of HIV-associated neurocognitive disorder (HAND) severity. MMP-8 -799TT genotype may facilitate the risk for the development of HAND with tobacco and alcohol usage. PMID: 29292194
  15. Our study provides evidence for the tumour-suppressive mechanisms of MMP-8 in OTSCC by interplay with TGF-b1 and VEGF-C. PMID: 28772283
  16. These results provide the first evidence that MMP8 SNP at the rs11225394 locus is associated with the increased risk of osteonecrosis of the femoral head in Chinese Han population. PMID: 28423488
  17. Low MMP-8/TIMP-1 reflects left ventricle impairment in takotsubo cardiomyopathy and high TIMP-1 may help to differentiate it from acute coronary syndrome PMID: 28278213
  18. there is a negative correlation between blood MMP8 and HDL-cholesterol levels, suggesting a contributory role of MMP8 in metabolic alterations in acne inversa PMID: 27843200
  19. MMP-8 is a vital component of the myoepithelial tumour-suppressor function. It restores MEC interaction with the matrix, opposes TGF-beta signalling and MMP-9 proteolysis, which contributes to inhibition of tumour cell invasion. PMID: 28330493
  20. a 7-gene signature was identified which correctly predicted the primary prefibrotic myelofibrosis group with a sensitivity of 100% and a specificity of 89%. The 7 genes included MPO, CEACAM8, CRISP3, MS4A3, CEACAM6, HEMGN, and MMP8 PMID: 27579896
  21. Obesity is associated with elevated circulating MMP-8 in young adults. MMP-8 is also increased in smokers. PMID: 27296149
  22. Serum level patterns of MMP-2 and MMP-8 showed distinctive patterns for patients with spinal cord injury neurological impairment. MMP-8 and MMP-9 patterns showed significant differences regarding functional recovery. Our binary logistic regression model showed that, according to neurological damage, measuring peripheral serum levels can be used to monitor and predict locomotor recovery after spinal cord injury. PMID: 27377304
  23. rs1940475 and rs11225395 associated with 1.32-fold increased risk of steroid-induced osteonecrosis of the femoral head PMID: 27631232
  24. Blood expression of matrix metalloproteinases 8 and 9 and of their inducers S100A8 and S100A9 supports diagnosis and prognosis of PDAC-associated diabetes mellitus PMID: 26923392
  25. Plasma MMP-8 and MMP-9 concentrations correlate with diabetic ketoacidosis severity and are known to degrade brain microvascular endothelial cell tight junctions. Thus, leukocyte-derived MMPs might contribute to DKA-associated cerebrovascular complications. PMID: 26492282
  26. Initial analysis of the MMP8 gene showed suggestive association between rs1940475 and knee OA, but the finding did not replicate in other study cohorts, even though the trend for predisposing allele was similar in all five cohorts. MMP-8 is a good biological candidate for OA, but our study did not find common variants with significant association in the gene. PMID: 26577236
  27. Sputum, serum, and urine MMP-8 were not significantly changed in COPD exacerbation compared to recovery values. PMID: 26418236
  28. amniotic fluid concentrations in acute-chorioamnionitis distinctly decrease throughout preterm-gestation PMID: 26462905
  29. Suggest that MMP-8 polymorphism -799 C/T was a risk for developing chronic periapical lesions. PMID: 27442388
  30. The reciprocal positive interplay between MMP-8 and TGF-beta1 contributes to HCC invasion and metastasis by inducing EMT mainly through the PI3K/Akt/Rac1 pathway. PMID: 26872724
  31. increased levels in saliva and serum in women with polycystic ovary syndrome, and is potentiated in the presence of gingivitis PMID: 25712810
  32. Positive results of the aMMP-8 test significantly correlate with generalized ChP. The aMMP-8 test may be used by physicians to detect periodontitis in their patients. PMID: 25841875
  33. miR-539 plays a key role in inhibiting osteosarcoma cell invasion and migration and can regulate MMP8 expression in osteosarcoma cells. PMID: 26339374
  34. salivary levels of the analyzed biomarkers MMP-8, -9, MPO are associated with periodontal status. However, these biomarkers could not differentiate between patients with or without a MI. PMID: 26132583
  35. Moderate-strength STS causes the highest TIMP-1/MMP-8 ratio, leading to appropriate conditions for reformation of the extracellular matrix PMID: 23851938
  36. Gender-specific analysis of MMPs demonstrated consistent increase in MMP-1 and -8 in tuberculosis, but MMP-8 was a better discriminator for TB in men. PMID: 25635689
  37. MMP-8, MMP-9, and YKL-40 might serve as novel non-invasive biomarkers of CF lung disease and pulmonary exacerbations. PMID: 25545245
  38. Low levels of plasma MMP8 levels can rule out acute aortic dissection. PMID: 23442769
  39. investigated whether MMP-8 affects the structure and antiatherogenic function of apolipoprotein (apo) A-I, the main protein component of HDL particles PMID: 25550459
  40. Strong associations of MMP-8 with components of Metabolic Syndrome X in univariate, bivariate and multivariate models suggest plasma MMP-8 as a potential cardiometabolic risk marker for Metabolic syndrome X. PMID: 25633268
  41. it can be suggested that MMP-8 -799 C/T and TIMP-1 372 T/C, *429 T/G gene polymorphisms in males may be associated with the susceptibility to GAgP in the Turkish population. PMID: 24283658
  42. Studied plasma MMP-8 levels and its correlates 20+/-3 months after acute myocardial infarction. PMID: 24164993
  43. The 799C/T polymorphism in the promoter region of MMP8 may be associated with the development of TAD and that the T allele may increase patient predisposition to the disease. PMID: 25109362
  44. MMP-8 promoter gene polymorphism -799 T/T is significantly associated with an increased risk of ovarian cancer in Mexican women. PMID: 25034366
  45. patients with high serum MMP-8 levels may benefit from adjuvant IFN-alpha therapy, but this observation should be further investigated. PMID: 25319807
  46. Plasma and BALF MMP-8 levels are unlikely to serve as a prognostic biomarker for IPF patients. PMID: 24828408
  47. MMP8 rs1940475 SNP modifies the host response to inflammatory stimuli. PMID: 24170307
  48. The polymorphism at position -799 of the gene for MMP-8 is associated with tendinopathy primary posterior tibial tendon in the population studied. The results suggest that individuals with the T allele are at greater risk of developing tendinopathy. PMID: 22487237
  49. Studied the plasma concentrations of MMP-8, TIMP1, C-reactive protein, fibrinogen, and WBCs in patients with acute coronary syndrome and found levels were significantly higher than those in the control group. PMID: 25016699
  50. Plasmatic OxLDL and MMP-8 levels are associated with carotid atherosclerosis PMID: 24267248

Show More

Hide All

Subcellular Location
Cytoplasmic granule. Secreted, extracellular space, extracellular matrix. Note=Stored in intracellular granules.
Protein Families
Peptidase M10A family
Tissue Specificity
Neutrophils.
Database Links

HGNC: 7175

OMIM: 120355

KEGG: hsa:4317

STRING: 9606.ENSP00000236826

UniGene: Hs.161839

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*