Recombinant Human Noggin (NOG)

In Stock
Code CSB-EP015917HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
NOG
Uniprot No.
Research Area
Developmental Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
28-232aa
Target Protein Sequence
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
58.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression of the recombinant Human NOG protein entails introducing a DNA expression vector containing the gene for the desired protein (28-232aa) into e.coli cells through transformation. Subsequently, the cells are cultured to facilitate the expression of the intended protein. The protein features a N-terminal 10xHis-GST tag and C-terminal Myc tag fusion. The resulting recombinant Human NOG protein is then gathered and purified from the cell lysate using affinity purification. Its purity, determined by SDS-PAGE, exceeds 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Essential for cartilage morphogenesis and joint formation. Inhibits chondrocyte differentiation through its interaction with GDF5 and, probably, GDF6.
Gene References into Functions
  1. studies support previous work that suggest Noggin is an important suppressor of the differentiation of osteoblast lineage cells in bone metastases; now it is also shown that this protein can be induced in bone cells themselves by factors derived from prostate cancer cells PMID: 28981962
  2. Report of a novel missense NOG mutation and phenotypic variability in an Indian family where multiple members were affected with tarsal-carpal coalition syndrome with multiple synostoses and proximal symphalangism. PMID: 29159868
  3. Study suggested that the NOGGIN rs227731 polymorphism may increase nonsyndromic cleft lip with or without palate risk in Caucasians and may have no significant association in the Chinese population (meta-analysis). PMID: 28398705
  4. The clinical presentation of the reported mutation corresponds with previous case reports of families with NOG mutation. In this family, surgery with stapedectomy had lasting effect without renewed fixation of the stapes in a follow up period of 18 months-38 years. PMID: 29605356
  5. we describe a Danish family suffering from SYNS1 due to a novel NOG gene mutation (C230Y). We provide detailed clinical description of the family members presenting rare phenotype of the shoulders shared by affected individuals but no hearing loss, further adding to the phenotypic variability of the syndrome. PMID: 26994744
  6. A New Subtype of Multiple Synostoses Syndrome Is Caused by a Mutation in GDF6 That Decreases Its Sensitivity to Noggin and Enhances Its Potency as a BMP Signal. PMID: 26643732
  7. An imbalance between BMP-2 and Noggin secretion induces abnormal osteogenic differentiation of ankylosing spondylitis-mesenchymal stem cells. PMID: 26413886
  8. early noggin exposure may play a specific role in the directed differentiation of DA cells from human embryonic stem cells. PMID: 26383864
  9. By next-generation and Sanger sequencing analyses, study identified two novel mutations, c.559C>G (p.P178A) and c.682T>A (p.C228S), in the proximal symphalangism and atypical multiple synostosis syndrome families, respectively. PMID: 25391606
  10. Novel p.W150C NOG mutation associated with proximal symphalangism and conductive hearing impairment was identified in a Chinese family.Impaired dimerization of mutant NOG is an important pathogenic mechanism for the NOG-related disorder. PMID: 25888563
  11. No association between SPRY2, single-nucleotide polymorphisms, and nonsyndromic cleft lip with or without cleft palate risk were observed in this cohort of patients. PMID: 25339627
  12. The study did not provide support for NOG being the causal gene at 17q22 in nonsyndromic cleft lip with or without cleft palate. PMID: 24706492
  13. a novel NOG mutation in a Chinese family with proximal symphalangism PMID: 24326127
  14. this study proposes that the decreased binding affinity of NOG with the p.R136C mutation to HSPG leads to an excess of bone morphogenetic protein signaling and underlies the proximal symphalangism and conductive hearing loss phenotype of carriers. PMID: 24735539
  15. High-quality studies show that otosclerosis in Japanese patients is not linked to the NOG gene. [Review] PMID: 24170657
  16. Even though gremlin 1 and noggin were not widely expressed in adult tissues, in a subset of organs their expression pattern indicated a potential role in normal tissue homeostasis as well as in malignancies. PMID: 23826422
  17. A novel heterozygous change of p. R42T [c.C124A (CCC > ACC)] leading to a proline was identified in a family with multiple synostoses syndrome. PMID: 23732071
  18. NOggin attenuates BMP4-mediated transdifferentiation of human valve interstitial cells towards an osteogenic-like phenotype in aortic valve sclerosis. PMID: 23483047
  19. Mutations in the NOG gene are commonly found in congenital stapes ankylosis with symphalangism, but not in otosclerosis. PMID: 22288654
  20. Noggin suppression decreased viability and BMP-2-induced osteogenic differentiation of human mesenchymal stem cells. PMID: 22740073
  21. BMP2 treatment reduced noggin expression, which resulted in increased expression of apoptotic markers and increased apoptosis of osteoblasts. PMID: 22628200
  22. high BMP6 activity, defined by strong BMP6 expression with weak noggin or SOST expression, was associated with shorter survival in esophageal SCC patients; results suggest BMP6, noggin and SOST could be used in combination as a prognostic indicator in cancer progression PMID: 22364398
  23. p.G92E represents a rare polymorphism of the NOGGIN gene-- causing neither brachydactyly nor fibrodysplasia ossificans progressiva. PMID: 22529972
  24. Human squamous cell carcinomas and malignant melanomas contain significantly more Myo/Nog cells than basal cell carcinomas. PMID: 22621191
  25. we conclude that mutations in the coding region of NOG are rare, and play at most an uncommon role in human Holoprosencephaly (HPE). PMID: 22503063
  26. Using genetic approaches, we show that when NOG is expressed in human breast cancer cells, it facilitates bone colonization by fostering osteoclast differentiation and bone degradation and also contributes to metastatic lesions reinitiation. PMID: 22547073
  27. SNPs in the coding region of the NOG gene are identified infrequently in human cases of EA/TEF PMID: 22083168
  28. evidence for a model of osteolytic bone metastasis where constitutive secretion of noggin by cancer cells mediates inhibition of bone formation, thereby preventing repair of osteolytic lesions generated by an excess of osteoclast-mediated bone resorption. PMID: 21249149
  29. secreted levels of noggin were decreased in untreated patients with relapsing-remitting Multiple sclerosis PMID: 21111488
  30. study reports on a family with facioaudiosymphalangism syndrome with overgrowth due to a novel heterozygous NOG missense mutation (c.696C > G, p.Cys232Trp) PMID: 20503332
  31. This result suggests that there may be population polymorphism, or markers that are seldom polymorphic for our population PMID: 20645637
  32. Using BMP-6/7 chimeras, we identified lysine 60 as a key residue conferring noggin resistance within the BMP-6 protein. PMID: 20048150
  33. This study showed that constitutive and orthotopic Noggin protein expression did not influence cell proliferation, down-regulated BMP-2 expression, and showed no effect on BMP receptor transcripts. PMID: 19692649
  34. A novel NOG gene mutation giving rise to the (P35S) amino acid substitution has been identified in an Italian family with symphalangism. PMID: 11857750
  35. Autosomal dominant stapes ankylosis with broad thumbs and toes, hyperopia, and skeletal anomalies is caused by heterozygous nonsense and frameshift mutations in NOG, the gene encoding noggin PMID: 12089654
  36. crystal structure of the antagonist Noggin bound to BMP-7, which shows that Noggin inhibits BMP signalling by blocking the molecular interfaces of the binding epitopes for both type I and type II receptors PMID: 12478285
  37. Nog gene is connected to stapes ankylosis. PMID: 12621334
  38. Here, we show that the overexpression of human noggin, by acting to inhibit glial differentiation by subependymal progenitor cells, can potentiate adenoviral BDNF-mediated recruitment of new neurons to the adult rat neostriatum PMID: 14999064
  39. Mutations in the nog gene have been identified. PMID: 15264296
  40. These studies highlight the critical role played by Cys168 in noggin's biological activities. PMID: 15756420
  41. Overexpression of noggin in PC-3 cells inhibited the expansion of the lesion in vivo. PMID: 16126463
  42. Data show calcium-sensing receptor stimulation of T-84 epithelia and colonic myofibroblasts downregulated the BMP family antagonist Noggin. PMID: 17138967
  43. Lack of noggin expression by cancer cells may be a relevant mechanism contributing to the osteoblast response in bone metastases PMID: 17200191
  44. Antagonism of bone morphogenetic protein signaling by transgenic Noggin plays a critical role in ensuring proper levels of cell proliferation and epithelial-to-mesenchymal transformation during cardiac morphogenesis. PMID: 17218603
  45. Expression analysis of additional genes, AKT1, NOG and its antagonist BMP4, which interact downstream to FGFR1, demonstrated expression differences between primary rhabdomyosarcoma tumors and normal skeletal muscles PMID: 17696196
  46. NOG is involved in myeloproliferative disease associated with myelofibrosis PMID: 17889703
  47. Various mutations may occur in myositis ossificans nuclear families. PMID: 18019378
  48. Heterozygous gene mutations in NOGGIN are associated with tall stature in children but not necessarily in adults. PMID: 18204269
  49. Transgenic noggin overexpression increases the total number of neurons in the colon; the density of colonic neurons increases significantly in both Nog/+ and Nog/Nog mice, although the two groups of transgenic animals do not differ significantly. PMID: 18537141
  50. Advanced melanoma cells may escape from BMP7-induced inhibition through concomitant aberrant expression of Noggin. PMID: 18560367

Show More

Hide All

Involvement in disease
Symphalangism, proximal 1A (SYM1A); Multiple synostoses syndrome 1 (SYNS1); Tarsal-carpal coalition syndrome (TCC); Stapes ankylosis with broad thumb and toes (SABTS); Brachydactyly B2 (BDB2)
Subcellular Location
Secreted.
Protein Families
Noggin family
Database Links

HGNC: 7866

OMIM: 184460

KEGG: hsa:9241

STRING: 9606.ENSP00000328181

UniGene: Hs.248201

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*