Recombinant Human Orexin receptor type 2 (HCRTR2), partial

In Stock
Code CSB-EP010232HU1
Abbreviation Recombinant Human HCRTR2 protein, partial
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
Ox-2-R;Ox2-R;Ox2R;Hypocretin receptor type 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-54aa
Target Protein Sequence
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.5 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Gene References into Functions
  1. The rs2653349 (G1246A) polymorphism of the HCRTR2 gene reduces the chance of developing cluster headache. PMID: 29959630
  2. Association between HCRTR2, ADH4,CLOCK gene polymorphisms and cluster headache was not significant in the present study. PMID: 29318394
  3. The present study demonstrated that aa residues in the C-terminus serve an important role in the expression and signal transduction of OX2R. In addition, the aa residues in different locations possess evidentially different roles. PMID: 28487995
  4. This study showed that Lack of Association between Genetic Polymorphism of ox2r gene with Late Onset Depression and Alzheimer's Disease in a Sample of a Brazilian Population PMID: 27335043
  5. G-protein-dependency of OX2 receptor signalling PMID: 27237973
  6. Rapid-onset obesity with hypothalamic dysfunction, hypoventilation, and autonomic dysregulation is highly unlikely to be caused by mutations in the exons of the HCRTR2 gene. PMID: 26555080
  7. The study determined structures of OX1R bound to the OX1R-selective antagonist SB-674042 and the dual antagonist suvorexant at 2.8-A and 2.75-A resolution and explored mechanisms of antagonist the subtype selectivity between OX1R and OX2R. PMID: 26950369
  8. our meta-analysis provides genetic evidence for a role of HCRTR2 in cluster headache PMID: 25398231
  9. Heart failure patients with minor allele for rs7767652, upstream of hypocretin (orexin) receptor-2 (HCRTR2), were less likely to have improved left ventricular function and a lower prevalence of ejection fraction >35% PMID: 26653627
  10. the nonsynonymous rs2653349 single nucleotide polymorphism (SNP) (located on the gene that encodes orexin [hypocretin] receptor 2) was selected as the most notable SNP associated with Fagerstrom Test for Nicotine Dependence. PMID: 26289589
  11. Antibodies from vaccine-associated narcolepsy sera cross-reacted with both influenza nucleoprotein and hypocretin receptor 2. PMID: 26136476
  12. The genotypic and allelic frequencies of the rs2653349 polymorphism were different between Alzheimer's disease patients and controls. The carriage of the G allele was associated with an increased AD risk. PMID: 24969517
  13. using lipid-mediated crystallization and protein engineering with a novel fusion chimaera, the structure of the human OX2R bound to suvorexant at 2.5 A resolution is solved PMID: 25533960
  14. DQ B1 but not HLA-DR typing, TNF-alpha levers, HCRTR1 and HCRTR2 were higher in narcolepsy-cataplexy/schizophrenia patients. PMID: 24268496
  15. Orexinergic innervation and expression of genes encoding OX2R receptor are upregulated in transgenic mice at dusk. PMID: 24599460
  16. Expression of the OX2R protein was detected in normal endometrial epithelia, whereas it was frequently lacking in endometrial endometrioid carcinoma. PMID: 23482607
  17. Data demonstrated that hOX2R expression is regulated by a complex involving a proximal PKA/PKC-regulated promoter and a distal promoter regulating tissue-specific expression of alternative transcripts which in turn regulate receptor levels. PMID: 20156195
  18. The data suggest that the HCRTR2 gene or a linked locus significantly modulates the risk for cluster headache. PMID: 15477554
  19. All adrenal cortex adenomas expressed OX1-R and OX2-R mRNAs, and real-time PCR showed that the expression of both receptors was up-regulated in adenomas PMID: 15797953
  20. Our results do not support a role of the HCRTR2 G1246A polymorphism in drug responses in CH. PMID: 17376114
  21. polymorphism of the HCRTR2 gene may modulate the genetic risk for cluster headache PMID: 17563843
  22. the HCRTR2 gene is not a genetic risk factor in migraine. PMID: 17645762
  23. This study does not support a major contribution of the HCRTR2 G1246A polymorphism to the pathogenesis of migraine in contrast to its effects in cluster headache. PMID: 17883525
  24. Three new polymorphisms of the HCRTR2 gene are significantly associated with cluster headache. PMID: 18399985
  25. This study describes the intracellular signalling pathways involved in OX2R-mediated ERK(1/2) and p38 MAPK activation. PMID: 18599270
  26. Biochemical and behavioural characterization of EMPA, a novel high-affinity, selective antagonist for the OX(2) receptor. PMID: 19751316

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 4849

OMIM: 602393

KEGG: hsa:3062

STRING: 9606.ENSP00000359899

UniGene: Hs.151624

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*