Recombinant Human Plasma kallikrein(KLKB1),partial

Code CSB-YP012461HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P03952
Relevance The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fletcher factor Kininogenin Plasma prekallikrein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR
Research Area Cell Biology
Source Yeast
Gene Names KLKB1
Protein Names Recommended name: Plasma kallikrein EC= 3.4.21.34 Alternative name(s): Fletcher factor Kininogenin Plasma prekallikrein Cleaved into the following 2 chains: 1. Plasma kallikrein heavy chain 2. Plasma kallikrein light chain
Expression Region 20-390aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 43.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Involvement in disease Prekallikrein deficiency (PKK deficiency)
Subcellular Location Secreted
Protein Families Peptidase S1 family, Plasma kallikrein subfamily
Database Links

HGNC: 6371

OMIM: 229000

KEGG: hsa:3818

STRING: 9606.ENSP00000264690

UniGene: Hs.237642

Pathway Complement and coagulation cascades

Related Products

KLKB1 Antibodies

KLKB1 Antibodies for Homo sapiens (Human)

KLKB1 Antibodies for Human

KLKB1 Proteins

KLKB1 Proteins for Homo sapiens (Human)

KLKB1 ELISA Kit

KLKB1 ELISA Kit for Homo sapiens (Human)

KLKB1 ELISA Kit for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.