Recombinant Human Plasma kallikrein (KLKB1), partial

Code CSB-YP012461HU
Abbreviation Recombinant Human KLKB1 protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Fletcher factor; kallikrein B plasma; Kallikrein B plasma (Fletcher factor) 1; Kallikrein B; plasma 1; Kallikrein B1; Kininogenin; KLK3; KLKB1; KLKB1_HUMAN; PKK; PKKD; Plasma kallikrein; Plasma kallikrein B1; Plasma kallikrein light chain; Plasma prekallikrein; PPK; Prekallikrein
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
20-390aa
Target Protein Sequence
GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Gene References into Functions
  1. We further define the interactions of keratinocyte PKK with TP63 and NF-kappaB signaling, highlighting the importance of this protein as a tumor suppressor in skin squamous cell carcinoma development. PMID: 29186361
  2. Plasma kallikrein (PLK)-dependent transforming growth factor-beta (TGF-beta) activation could be detected in isolated pancreatic stellate cells (PSCs) from chronic pancreatitis (CP) and pancreatic cancer. PMID: 28187111
  3. High molecular weight kinin functions as a cofactor for PK activation in the presence of nucleic acids in a manner consistent with classic models of contact activation. PMID: 28124063
  4. genetic polymorphism is associated with C1 Inhibitor deficiency angioedema age of onset in European families PMID: 29130992
  5. these data indicate that KLKB1 induces inflammatory reactions in human dental tissues via protease-activated receptor 1 PMID: 26566265
  6. von Willebrand factor activity and concentration of prekallikrein may both be of importance regarding the evolution of thrombus in abdominal aortic aneurysm and possible biomarkers for aneurysm growth. PMID: 27581227
  7. KLKB1 mRNA expression is a putative molecular biomarker in chronic lymphocytic leukemia. PMID: 25891023
  8. Genotyping these subjects revealed that the carriers of the minor alleles at the two loci- F12 and KLKB1 had a significant association with reduced levels of active plasma renin. PMID: 26969407
  9. 2 genetic loci (kininogen 1 and kallikrein B) influencing key components of the RAAS, consistent with the close interrelation between the kallikrein-kinin system and the RAAS. PMID: 25477429
  10. PRCP1 interacts with plasma kallikrein (PK) at multiple sites for PK activation. PMID: 25324000
  11. Prekallikrein deficiency in a family is due to a new mutation (Arg541Gln) in exon 14. PMID: 25075649
  12. FXI may have a role in risk of ischemic stroke, but not myocardial infarct; FXII and prekallikrein may not have a role in either PMID: 24977287
  13. The acquisition of an active site in prekallikrein as a result of binding to high-molecular-weight kininogen (HK) is a new concept for bradykinin formation and might be relevant in the pathogenesis of hereditary angiodema types I and II. PMID: 23672780
  14. Investigate the relationship between circulating PK levels in children with metabolic syndrome and CVD risk factors because PK may be involved in the progression of the disease state. PMID: 20725119
  15. Case Report: Fresh frozen plasma transfusion before coronary artery bypass corrects prekallikrein deficiency. PMID: 20135073
  16. plasma kallikrein and FXIa activate pro-HGF in vitro PMID: 12372819
  17. the effect of kininogen degradation by human neutrophil elastase (HNE) on kinin generation by tissue and plasma kallikreins. PMID: 12887060
  18. prekallikrein preferential binding to endothelial cells contributes to their anticoagulant nature PMID: 12944405
  19. Crystallization and x-ray crystal structure determination have yielded the first three-dimensional views of the catalytic domain of plasma kallikrein PMID: 16199530
  20. Our findings suggested that common genetic variation in the KLKB1 gene might contribute to the risk of hypertension in the northern Han Chinese population. PMID: 17318641
  21. study demonstrates by immunohistochemistry that plasma kallikrein (PK) is localised in cells of different embryologically derived human tissues PMID: 17696780
  22. three-dimensional structural data for prekallikrein (PK); interaction between PK and high-molecular-weight kininogen is mediated by two discrete surfaces formed by the PK A1, A2 and A4 domains with charge likely to be a critical component of the binding PMID: 17922805
  23. Kallikrein can directly activate prothrombin; there is a shortcut in the intrinsic hemostasis system that generates catalytic amounts of thrombin without following the known intrinsic clotting pathway PMID: 18160576
  24. Kallikrein is responsible for the cleavage of factor H. PMID: 18413232
  25. prekallikrein is an enzyme that can cleave high-molecular-weight kininogen to release bradykinin, and this reaction is inhibited by C1 inhibitor. PMID: 19342086
  26. NPY3-35 is a new peptide generated by plasma kallikrein PMID: 19620246

Show More

Hide All

Involvement in disease
Prekallikrein deficiency (PKK deficiency)
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Plasma kallikrein subfamily
Database Links

HGNC: 6371

OMIM: 229000

KEGG: hsa:3818

STRING: 9606.ENSP00000264690

UniGene: Hs.237642

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*