Recombinant Human Platelet-derived growth factor D (PDGFD), partial

In Stock
Code CSB-EP887935HU
Abbreviation Recombinant Human PDGFD protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
PDGF-D;Iris-expressed growth factor;Spinal cord-derived growth factor B;SCDGF-B;PDGFD latent form;PDGFD receptor-binding form
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
55-168aa
Target Protein Sequence
TIQVKGNGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix.
Gene References into Functions
  1. PDGF-D promotes tumor growth and aggressiveness of colorectal carcinoma. Down-regulation of PDGF-D inactivates Notch1/Twist1 axis, which could reverse epithelial mesenchymal transformation and prevent CRC progression. PMID: 28035069
  2. significant correlations between DNA methylation of the PDGFD gene promoter and the risk of developing either IA or BAVM PMID: 28346846
  3. This study suggested that epithelial-mesenchymal transition process can be triggered by the PDGF-D/PDGFRb axis in tongue squamous cell carcinoma, and then involved in the tumor cell invasion via activation of p38/AKT/ERK/ epithelial-mesenchymal transition pathway. PMID: 27507215
  4. No specific genotype of rs974819 of Platelet-derived growth factor D demonstrated increased cardiovascular mortality in the total population, however, the male group with genotypes A/A and G/A demonstrated an increased risk that persisted in a multivariate evaluation where adjustments were made for well-known cardiovascular risk factors. PMID: 27585990
  5. upregulated in kidney fibrosis, may mediate renal scarring, and is dispensable for normal kidney development and physiological functions PMID: 26924050
  6. polymorphism of rs7950273 in the PDGFD gene is not associated with ischaemic stroke in the Chinese Han population PMID: 26362023
  7. Novel findings reveal a new paradigm in matriptase activation involving PDGF-D-specific signal transduction leading to extracellular acidosis. PMID: 26157007
  8. PDGF-D expression is associated with miR-106a and Twist1 in HCC patients PMID: 25760076
  9. PDGF-D is highly expressed by ASCs, where it acts as a potent mitogenic factor. PMID: 25332166
  10. PDGFD, CDH1 and SLIT2 are upregulated in low grade meningiomas and schwannomas compared with healthy tissue. PMID: 25333347
  11. PDGF-DD secreted by gastric cancer derived mesenchymal stem cells is capable of promoting gastric cancer cell progression in vitro and in vivo. PMID: 24938433
  12. Data suggest that targeting platelet-derived growth factor-D as a strategy for endometrial cancer treatment. PMID: 24646915
  13. Compared with matched normal endometrial cases, PDGF-D was up-regulated in endometrial cancer. Expression of PDGF-D protein, found in 78% of the cases, was associated with nonendometrioid histologic type. PMID: 24870786
  14. PDGFD-PDGFRbeta signalling is required for human neocortical development and local production of growth factors by radial glia supports the expanded germinal region and progenitor heterogeneity of species with large brains PMID: 25391964
  15. PDGF-D is highly expressed in gemcitabine resistant (GR) liver neoplasm cells. Furthermore, down-regulation of PDGF-D in GR cells led to partial reversal of the EMT phenotype. PMID: 24158561
  16. Down-regulation of platelet-derived growth factor-D expression blockades NF-kappaB pathway to inhibit cell proliferation and invasion as well as induce apoptosis in esophageal squamous cell carcinoma. PMID: 23187740
  17. Platelet-derived growth factor-D and Rho GTPases regulate recruitment of cancer-associated fibroblasts in cholangiocarcinoma. PMID: 23505219
  18. Taken together with our previous finding that matriptase is a proteolytic activator of PDGF D, this study provides a molecular insight into signal amplification of the proteolytic network and PDGF signaling loop during cancer progression. PMID: 22689130
  19. Meta-analysis showed that single nucleotide polymorphism rs974819 of PDGFD gene was significantly associated with an increasing risk of coronary heart disease (OR=1.08, 95% CI=1.05 - 1.11) in both Europeans and South Asians including Han Chinese. PMID: 22704460
  20. High PDGFD expression promotes ovarian cancer invasion by regulating matrix metalloproteinases 2 and 9 PMID: 22471482
  21. PDGF-D promotes malignant mesothelioma cell chemotaxis through PDGF-betabeta receptor signaling pathways along a PI3 kinase/PDK1/Akt/Rac1/ROCK axis and relevant to ERK activation PMID: 22415093
  22. The results of this study suggested that PDGFD -858A/C variant is probably associated with risk for non-hypertensive intracerebral hemorrhage. PMID: 22289441
  23. Study unveiled a novel signaling axis of matriptase/PDGF-D/beta-PDGFR in PCa, providing new insights into functional interplay between serine protease and growth factor signaling networks. PMID: 21098708
  24. human umbilical cord blood tropism toward glioma cells are partially dependent on the PDGF/PGGFR system. PMID: 20406896
  25. Compared with control group, levels of PDGF-D and PDGF-B were progressively elevated in blood and urine of IgA nephropathy children. PMID: 18471357
  26. LH significantly increased PDGF-D messenger RNA (mRNA) expression but suppressed PDGF-B and PDGF-C mRNA in human granulosa-luteal cells PMID: 19733850
  27. PDGF-D-induced acquisition of the EMT phenotype in PC3 cells is, in part, a result of repression of miR-200. PMID: 19544444
  28. Platelet-derived growth factor D: tumorigenicity in mice and dysregulated expression in human cancer PMID: 11980634
  29. we localized PDGF-D in human kidneys suggesting that PDGF-D may have a role in kidney development. PMID: 12427128
  30. PDGF-D plays an important role in the pathogenesis of tubulointerstitial injury through binding of PDGF-Rbeta in both human obstructive nephropathy PMID: 14514732
  31. full-length PDGF-D is activated in tissues and is capable of increasing interstitial fluid pressure and macrophage recruitment and the maturation of blood vessels in angiogenic processes. PMID: 15271796
  32. PDGF D is activated and processed by urokinase plasminogen activator and they colocalize in human prostate carcinoma. PMID: 15988036
  33. Sp1, like Ets-1, induces PDGF-D transcription and mRNA expression; H2O2 stimulates Ets-1, but not Sp1, and activates D3-dependent PDGF-D transcription PMID: 16189269
  34. PDGF-D is present in the neointima of the arteriopathy of Chronic allograft nephropathy, where it can engage PDGF-Rbeta to promote mesenchymal cell migration, proliferation, and neointima formation. PMID: 18187181
  35. All 3 residues in Sp1 (Thr668, Ser670, and Thr681) are required for Sp1-dependent platelet-derived growth factor-D activation in response to angiotensin II PMID: 18258854
  36. PDGF-D promotes epithelial-mesenchymal transitiion and thus could be a novel therapeutic target for the prevention and/or treatment of prostate cancer. PMID: 18403754
  37. Association of platelet-derived growth factor-D gene polymorphism with ischemic stroke in a Chinese case-control study PMID: 18600092
  38. uPA not only generates active PDGF-DD, but also regulates its spatial distribution, provides novel insights into the biological function of PDGF-DD. PMID: 18997817
  39. PDGF-DD, a novel mediator of smooth muscle cell phenotypic modulation, is upregulated in endothelial cells exposed to atherosclerosis-prone flow patterns. PMID: 19028801
  40. PDGF-DD serum levels in patients with IgA nephropathy (IgAN) were significantly higher (1.67 +/- 0.45 ng/ml) and in patients with lupus nephritis significantly lower (0.66 +/- 0.86 ng/ml) compared to healthy controls. PMID: 19357108

Show More

Hide All

Subcellular Location
Secreted. Note=Released by platelets upon wounding.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
Expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen and colon. In the kidney, expressed by the visceral epithelial cells of the glomeruli. A wides
Database Links

HGNC: 30620

OMIM: 609673

KEGG: hsa:80310

STRING: 9606.ENSP00000376865

UniGene: Hs.352298

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*