Recombinant Human Platelet glycoprotein VI (GP6), partial (Active)

In Stock
Code CSB-MP872550HU
Abbreviation Recombinant Human GP6 protein, partial (Active)
MSDS
Size $256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human GP6 protein at 2 μg/mL can bind Anti-GP6 recombinant antibody (CSB-RA872550MA1HU). The EC50 is 3.598-4.105 ng/mL.
Target Names
Uniprot No.
Alternative Names
Platelet glycoprotein VI ; GPVI ; Glycoprotein 6; GP6
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-267aa
Target Protein Sequence
QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK
Mol. Weight
28.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN) and SYK, the adapter protein LAT and leads to the activation of PLCG2.
Gene References into Functions
  1. there is an altered activation state of GPVI signaling in ST-elevation myocardial infarction patients; GPVI is critical for the formation of arterial thrombosis in vivo PMID: 28004756
  2. haplotype PEAN associated with SPS and manifested by fetal loss and suggest that the mechanism involved in the action of GPVI has significant effect on GPVI-mediated signal transduction through Syk-phosphorylation. PMID: 28041267
  3. This suggests whereas platelet receptor shedding is mainly modulated by calcium-dependent signals, either platelet-surface interactions with the container walls during storage or induced shear stress under long-term agitation, might be also involved in the excessive shedding of GPVI during the storage of PRP-platelet concentrates. PMID: 27778530
  4. There was no evidence to suggest that polymorphisms of GP VI T13254C and GP Ibalpha VNTR were associated with CAD. PMID: 28607925
  5. Platelet adhesion to collagen induces GPVI dimer clustering. GPVI clustering increases both avidity for collagen and the proximity of GPVI-associated signaling molecules, which may be crucial for the initiation and persistence of signaling PMID: 28058806
  6. Loss of the platelet surface receptors GPIbalpha and GPVI in heart failure, CF-VAD and ECMO patients may contribute to ablated platelet adhesion/activation, and limit thrombus formation under high/pathologic shear conditions PMID: 27601054
  7. SGPVI was significantly lower in patients treated with NOACs. PMID: 27693274
  8. Novel antithrombotic peptides derived from trowaglerix that acts through GPVI antagonism with greater safety-no severe bleeding. PMID: 28596377
  9. rs1613662 polymorphism has an important role in the development of venous thromboembolism in the white race PMID: 28353616
  10. plasma sGPVI levels are related to platelet activation in Living Donor Liver Transplantation. Although the plasma levels of sGPVI in the survivors increased after the operation, those in the nonsurvivors were high only on day 3. PMID: 26346441
  11. results support the idea that genetic variability of GP6 regulatory regions can be associated with platelet hyperaggregability - a possible cause of miscarriage PMID: 26308704
  12. These results demonstrate that GP6 is a receptor for fibrin and provide evidence that this interaction contributes to thrombus growth and stability. PMID: 26282541
  13. data suggest a novel role for FAK in GPVI-dependent ROS formation and platelet activation and elucidate a proximal signaling role for FAK within the GPVI pathway. PMID: 25415317
  14. As sCD147 strongly correlates with platelet-specific sGPVI, a common platelet source and/or mechanism of release may contribute to sCD147 levels in vivo. PMID: 24245520
  15. This study identifies GPVI as a platelet receptor for polymerized fibrin with 2 major functions: (1) amplification of thrombin generation and (2) recruitment of circulating platelets to clots. PMID: 25977585
  16. measuring the level of sGPVI may be useful for assessing the activation of platelets in postoperative patients treated with anti-Xa agents and also for predicting the incidence of VTE in this population. PMID: 25253166
  17. Glaucocalyxin A inhibits platelet activation and thrombus formation preferentially via GPVI signaling pathway. PMID: 24386454
  18. The plasma levels of sGPVI were the highest in patients with TMA without markedly reduced ADAMTS13 and those were significantly reduced after plasma exchange. PMID: 24325877
  19. Results suggest that variants of GP6 SNPs, namely, rs1671153, rs1654410, rs1654419, and rs1613662, may be associated with risk of recurrent miscarriage. PMID: 25086789
  20. Lower platelet GPIV levels are associated with no-reflow phenomenon in patients with acute myocardial infarction. PMID: 24126767
  21. Studies indicate that Megakaryocyte maturation is accompanied by up-regulation of glycoprotein VI and down-regulation of leukocyte-associated immunoglobulin-like receptor-1. PMID: 20713462
  22. PAR4 and GPVI-mediated platelet reactivity involves 12-lipoxygenase PMID: 23784669
  23. RhoG is expressed and activated in platelets, plays an important role in GPVI-Fc receptor gamma-chain complex-mediated platelet activation, and is critical for thrombus formation in vivo. PMID: 24106269
  24. SNPs tested within the GPVI gene are not associated with rheumatoid arthritis susceptibility and/or severity. PMID: 23739280
  25. Results suggest that p21 activated kinase serves as an orchestrator of platelet functional responses after activation downstream of the platelet collagen receptor, glycoprotein receptor VI. PMID: 23640496
  26. In response to GPVI stimulation, OPHN1 becomes phosphorylated at Tyr370 and plays a role in the formation of filopodia during platelet spreading on collagen. PMID: 23619296
  27. analysis of hierachical protein recruitment to the inhibitory platelet receptor, G6B-b PMID: 23185356
  28. Our results, especially higher occurrence of four haplotypes in SPS patients, can support an idea that variability of the GP6 gene may be associated with the platelet hyperaggregability insticky platelet syndrome. PMID: 23168074
  29. Interaction between integrin alpha2beta1 and collagen type I takes place prior to collagen receptor activation. PMID: 23132859
  30. GP6 SNPs 1613662-G, 1671153-G and 1654419-A alleles are associated with an increased risk for deep venous thrombosis and sticky platelet syndrome. PMID: 22821001
  31. Reactive oxygen species generation downstream of GPVI or FcgammaRIIa consists of two distinct phases: an initial Syk-independent burst followed by additional Syk-dependent generation. PMID: 22489915
  32. Results support the idea that GP6 gene polymorphism may be associated with platelet hyperaggregability, a possible cause of fetal loss. PMID: 22901851
  33. The GPVI-specific agonist collagen-related peptide or thrombin further increases the number of dimers, thereby providing a feedback mechanism for reinforcing binding to collagen and platelet activation. PMID: 22773837
  34. analysis of platelet GPVI, a unique platelet-specific receptor with uses in diagnosis and/or disease prevention [review] PMID: 22274761
  35. Exposure of platelets to high shear induced a metalloproteinase-dependent GPVI cleavage, producing a ~55-kDa soluble ectodomain fragment & A ~10-kDa platelet-associated tail fragment. This may down-regulate GPVI expression. PMID: 22431567
  36. Collagen receptor GPVI is platelet-specific, constitutively expressed, and key regulator of thrombosis. Enhanced surface expression is associated with atherosclerotic diseases such as acute coronary syndrome and ischemic stroke. [review-type article] PMID: 21718237
  37. A preclinical tool (human GPVI as an antiplatelet target) is developed in a genetically modified mouse strain to evaluate the role of GPVI in various models of thrombosis. PMID: 22238212
  38. The rapid assembly of highly competent dimers of GPVI at sites of vascular lesion represents an important step in the sequence of events leading to platelet activation by collagen. PMID: 22155453
  39. Platelet GPVI surface expression is enhanced in patients with acute coronary syndrome with unclear electrocardiogram (ECG) findings and is strongly associated with myocardial ischemia. PMID: 20071043
  40. The effect of GPVI stimulation on levels of specific proteins in subcellular platelet compartments was compared and analysed. PMID: 22114104
  41. Polymorphic variation at the GP6 locus is associated with risk of acute myocardial infarction in men and women. PMID: 20227257
  42. the functional interactions between SSL5 and platelets, including the novel finding of a role for the GPVI receptor PMID: 21552524
  43. Coagulation-induced GPVI shedding via FXa down-regulates GPVI under procoagulant conditions. PMID: 21252089
  44. the minor allele of GP6 T13254C that reduces platelet activation and aggregation also may be associated with a reduced incidence of recurrent cardiovascular events and mortality, but is not associated with first MI PMID: 20723028
  45. Glycoprotein VI shedding is implicated in the pathology of acute ischemic stroke. PMID: 21193745
  46. In platelets, SLAP-2 may have function as a negative regulator of GPVI-mediated signaling by interacting with c-Cbl. PMID: 20828795
  47. A unique megakaryocytic cell line UT-7/TPO could respond to one of the primary platelet signals through GP (glycoprotein) VI and a secondary signal of the AA (arachidonic acid) cascade. PMID: 20522022
  48. Ablation of TULA-2 resulted in hyperphosphorylation of Syk and its downstream effector phospholipase C-gamma2 as well as enhanced platelet glycoprotein VI-mediated platelet functional responses. PMID: 20585042
  49. [review]role of GP6 in platelet activation and blood clotting; blockade of collagen binding to GPVI PMID: 20414836
  50. Data indicate signaling events triggered by specific ligation of GPIbalpha can lead to robust platelet activation, similar to GPVI, and help define GPIb-IX-V as both an adhesion and signaling receptor on platelets. PMID: 20367574

Show More

Hide All

Involvement in disease
Bleeding disorder, platelet-type 11 (BDPLT11)
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass membrane protein.; [Isoform 2]: Cell membrane; Single-pass membrane protein.
Tissue Specificity
Megakaryocytes and platelets.
Database Links

HGNC: 14388

OMIM: 605546

KEGG: hsa:51206

STRING: 9606.ENSP00000308782

UniGene: Hs.661752

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*