Recombinant Human Pro-glucagon (GCG), partial

In Stock
Code CSB-EP009315HU1
Abbreviation Recombinant Human GCG protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
GCG
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-50aa
Target Protein Sequence
RSLQDTEEKSRSFSASQADPLSDPDQMNED
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.; Potent stimulator of glucose-dependent insulin release. Also stimulates insulin release in response to IL6. Plays important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Has growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis.; Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.; Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.; May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
Gene References into Functions
  1. GPR119 is the oleoyl-lysophosphatidylinositol receptor that is required for GLP-1 secretion in enteroendocrine cells. PMID: 29883799
  2. RYGB increased circulating bile acids, ileal Takeda G protein-coupled receptor 5 (TGR5) and mTORC1 signaling activity, as well as GLP-1 production in both mice and human subjects. Inhibition of ileal mTORC1 signaling by rapamycin significantly attenuated the stimulation of bile acid secretion, TGR5 expression and GLP-1 synthesis induced by RYGB in lean and diet-induced obese mice. PMID: 29859856
  3. Glucagon role in the pathophysiology of type 2 diabetes.[review] PMID: 29024725
  4. This review summarizes the current knowledge regarding the role of GLP-1 in the protection against oxidative damage and the activation of the Nrf2 signaling pathway. [review] PMID: 29271910
  5. Study concludes that in healthy subjects, glucagon-like peptide-1 (GLP-1) increases cardiac output acutely due to a GLP-1-induced vasodilation in adipose tissue and skeletal muscle together with an increase in cardiac work. PMID: 28174344
  6. Chenodeoxycholic acid stimulates glucagon-like peptide-1 secretion in patients after Roux-en-Y gastric bypass. PMID: 28202805
  7. The results demonstrate that glucagon-like peptide-1 and insulin synergistically and additively activate vagal afferent neurons. PMID: 28624122
  8. DPP-4 activity and GLP-1total levels were higher in patients with microvascular complications associated with T2DM. Contrary to expectations, no negative correlation was seen between GLP-1 and DDP-4 levels. This result suggests the possible inefficacy of DDP-4 activity as a marker to predict in vivo degradation of endogenous GLP-1. PMID: 29061224
  9. Data suggest that cAMP acts as amplifier of insulin secretion triggered by Ca2+ elevation in beta-cells; both messengers are also positive modulators of glucagon release from alpha-cells, but in this case cAMP signaling may be the important regulator and Ca2+ signaling has a more permissive role. [REVIEW] PMID: 28466587
  10. This study provides evidence that, in HepG2 cells, GLP-1 may affect cholesterol homeostasis by regulating the expression of miR-758 and ABCA1. PMID: 29453982
  11. This study reports the transition dipole strengths and frequencies of the amyloid beta-sheet amide I mode for the aggregated proteins amyloid-beta1-40, calcitonin, alpha-synuclein, and glucagon. PMID: 28851219
  12. genetic association studies in population in China: Data confirm that an SNP in an intron of SLC47A1 (rs2289669) is associated with hypoglycemic response to metformin in patients with newly diagnosed type 2 diabetes; differential increases in basal GLP1 plasma levels are also related to this SNP. (SLC47A1 = solute carrier family 47 member 1; GLP1 = glucagon-like peptide-1) PMID: 28321905
  13. GLP-2 augmented BRIN BD11 beta-cell proliferation, but was less efficacious in 1.1B4 cells. These data highlight the involvement of GLP-2 receptor signalling in the adaptations to pancreatic islet cell stress. PMID: 28746825
  14. Glucagon-like peptide (GLP-2) stimulates cancer myofibroblast proliferation, migration and invasion; GLP-2 acts indirectly on epithelial cells partly via increased Insulin-like growth factor (IGF) expression in myofibroblasts. PMID: 28363795
  15. Describe model, in which the release of GIP/GLP-1 is stimulated by glucose in the proximal small intestine, and no differences in the secretion dynamics between healthy individuals and patients with T2D are identified after taking differences in glucose profiles into account. PMID: 28374974
  16. the solvent exposure of the two Phe sites along the glucagon sequence was determined, showing that 4F-Phe6 was fully solvent exposed and 4F-Phe22 was only partially exposed PMID: 28508109
  17. Data suggest that dose/intensity-response relationships exist between exercise intensity and total plasma PYY levels, though the effects on total plasma GLP1 levels and hunger perceptions seem unclear. (PYY = peptide YY ; GLP1 = glucagon-like peptide 1) PMID: 27721013
  18. GLP-2 could be considered an hormone causing positive energy balance, which, however has the role to mitigate the metabolic dysfunctions associated with hyper-adiposity. [review] PMID: 27664588
  19. Studies indicate that nutrient-induced glucagonlike peptide-1 (GLP-1) response was one of the best predictors of type 2 diabetes mellitus (T2DM) remission after Roux-en-Y-gastric-bypass (RYGB). PMID: 29040429
  20. Insulin resistance in non-diabetic individuals is associated with raised fasting GLP-1 levels but reduced GLP-1 responses to meal stimulation. PMID: 29097626
  21. Age-dependent human beta cell proliferation induced by glucagon-like peptide 1 and calcineurin signaling PMID: 28920919
  22. Data suggest early peaks in glucagon-like peptide-1 and glucagon secretion/blood level together trigger exaggerated insulinotropic response (high insulin secretion/level) to eating and consequent hypoglycaemia in patients with postprandial hypoglycaemia as a postoperative complication following Roux-en-Y gastric bypass for obesity complicated by type 2 diabetes; this retrospective cohort study was conducted in London. PMID: 28855269
  23. A common variant, i.e., single nucleotide polymorphism rs6741949, in the DPP4 gene interacts with body adiposity and negatively affects glucose-stimulated GLP-1 levels, insulin secretion, and glucose tolerance. PMID: 28750074
  24. Compared with the lean group, the obese group had significantly higher fasting and post-OGTT GIP levels, but similar fasting GLP-1 and significantly lower post-OGTT GLP-1 levels. PMID: 28655715
  25. Hemodialysis improves upper GI symptoms and gastric slow waves in CKD patients. An increase in ghrelin and a decrease in GLP-1 might be involved in the HD-induced improvement in gastric slow waves. PMID: 28566304
  26. Data suggest that, in obesity, serum levels of active GLP1 are down-regulated and serum levels of soluble DPP4 are up-regulated; DPP4 levels correlate negatively with active GLP-1 levels but are positively associated with insulin resistance; thus, DPP4 may be biomarker for insulin resistance. This study was conducted in Malaysia. (GLP1 = glucagon-like peptide 1; DPP4 = dipeptidyl peptidase 4) PMID: 28288852
  27. Insulin resistance, postprandial GLP-1 and adaptive immunity are the main predictors of NAFLD in a homogeneous population at high cardiovascular risk. PMID: 27134062
  28. Data suggest that laparoscopic sleeve gastrectomy (LSG) for morbid obesity improves insulin resistance after either fast or slow feeding/eating; these findings suggest a negligible contribution of anorexigenic gut peptides GLP1 (glucagon-like peptide 1) and PYY (peptide YY) from intestinal L cells in response to LSG-induced weight loss. PMID: 27022941
  29. L-trp is a luminal regulator of CCK release with effects on gastric emptying, an effect that could be mediated by CCK. L-trp's effect on GLP-1 secretion is only minor. At the doses given, the two amino acids did not affect subjective appetite feelings. PMID: 27875537
  30. rs12104705 CC genotype associated with both general obesity and abdominal obesity in case of new-onset diabetes PMID: 27998387
  31. The effects of GLP-1-based therapies on blood glucose in type 2 diabetics are not mediated through microvascular responses. PMID: 27562916
  32. Endogenous GLP1 is involved in the central regulation of feeding by affecting central responsiveness to palatable food consumption. PMID: 26769912
  33. secretion of oxyntomodulin in patients with type 2 diabetes is significantly impaired. PMID: 27322465
  34. Glucagon-like Peptide-1 Analogues Inhibit Proliferation and Increase Apoptosis of Human Prostate Cancer Cells PMID: 28008585
  35. The GLP-1 secretion after 75 g OGTT was impaired in newly diagnosed T2DM patients, inversely proportional to insulin resistance and hyperglycemia, and positively correlated with beta-cell function and insulin sensitivity. PMID: 26739974
  36. GLP-1 secretion increased in response to inflammatory stimuli in humans, which was associated to parameters of glucose metabolism and best predicted by IL6. PMID: 26842302
  37. Among young and healthy adults, GLP-1 levels are strongly and independently related to body fat mass especially in men, but not body mass index or waist circumference. PMID: 25865948
  38. Glucagon circulates in patients without a pancreas and glucose stimulation of the gastrointestinal tract elicits significant hyperglucagonemia in these patients. PMID: 26672094
  39. There is minor contribution of endogenous GLP-1 and GLP-2 to postprandial lipemia in obese men. PMID: 26752550
  40. Data suggest that endocrine responses differ between jejunal and gastric enteral feeding, with higher peak plasma CCK (cholecystokinin), PYY (peptide YY), and GLP-1/2 (glucagon-like peptides 1/2) concentrations being attained after jejunal feeding. PMID: 26762368
  41. Data suggest that capsaicin, an appetite suppressant dietary supplement (here, administered via intraduodenal infusion), does not act via alteration of secretion of satiety hormones GLP-1 (GLP-1) and PYY (peptide YY). PMID: 26718419
  42. Data show that NCI-H716 cells were immunostained for tumor necrosis factor receptor TNFR1, and TNFalpha treatment enhances glucagon-like peptide-1 (GLP-1) secretion. PMID: 26270730
  43. active GLP-1 produced in the islet stimulates cholecystokinin production and secretion in a paracrine manner via cyclic AMP and CREB. PMID: 25984632
  44. Data suggest that secretion of insulin and glucagon is up-regulated in subjects with type 2 diabetes with dyssomnia as compared to subjects with type 2 diabetes without dyssomnia; those with dyssomnia exhibit prehypertension and insulin resistance. PMID: 25957006
  45. no association of single nucleotide polymorphisms and type 2 diabetes mellitus susceptibility in Chinese population PMID: 25863010
  46. Data suggest plasma GLP1 (glucagon-like peptide 1) and PYY (peptide YY) can be regulated by digestion-resistant diet factors; intake of soluble dietary fiber (prebiotic Fibersol-2) in a tea with meal up-regulated plasma GLP1/PYY and decreased hunger. PMID: 25823991
  47. Glucagon has emerged as a key hormone for the regulation of glucose homeostasis and for development of type 2 diabetes. [Review] PMID: 25814364
  48. The PKC-dependent effect of GLP-1 on membrane potential and electrical activity was mediated by activation of Na(+)-permeable TRPM4 and TRPM5 channels by mobilization of intracellular Ca(2+) from thapsigargin-sensitive Ca(2+) stores PMID: 26571400
  49. The actions of GLP-2 are transduced by the GLP-2 receptor [GLP-2R], which is localized in the neurons of the enteric nervous system but not in the intestinal epithelium. PMID: 25218018
  50. GLP-1 increases PGC-1(alpha) expression by downregulating miR-23a in liver cells. PMID: 26315270

Show More

Hide All

Subcellular Location
Secreted.; [Glucagon-like peptide 1]: Secreted.
Protein Families
Glucagon family
Tissue Specificity
[Glucagon]: Secreted in the A cells of the islets of Langerhans.; [Glucagon-like peptide 1]: Secreted in the A cells of the islets of Langerhans. Secreted from enteroendocrine L cells throughout the gastrointestinal tract. Also secreted in selected neuron
Database Links

HGNC: 4191

OMIM: 138030

KEGG: hsa:2641

STRING: 9606.ENSP00000387662

UniGene: Hs.516494

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*