Recombinant Human Glucagon(GCG),partial

In Stock
Code CSB-YP009315HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01275
Lead Time 3-7 business days
Relevance Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycia. Plays an important role in initiating and maintaining hyperglycic conditions in diabetes.GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis.GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.Oxyntomodulin significantly reduces food intake. Inhibits gastric ptying in humans. Suppression of gastric ptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Incretin hormoneGlucagon-like peptide 1(7-37) ;GLP-1(7-37)Glucagon-like peptide 1(7-36) ;GLP-1(7-36)Glucagon-like peptide 2 ;GLP-2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Source Yeast
Gene Names GCG
Protein Names Recommended name: GlucagonCleaved into the following 8 chains: 1. Glicentin 2. Glicentin-related polypeptide Short name= 3. GRPP 4. Oxyntomodulin Short name= 5. OXM Short name= 6. OXY 7. Glucagon 8. Glucagon-like peptid
Expression Region 53-89aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 6.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.; FUNCTION
Subcellular Location Secreted
Protein Families Glucagon family
Tissue Specificity Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain.
Database Links

HGNC: 4191

OMIM: 138030

KEGG: hsa:2641

STRING: 9606.ENSP00000387662

UniGene: Hs.516494

Pathway Glucagon signaling pathway

Q&A and Customer Reviews

Q&A
Q:

Is the portion which is tagged a his-tag in this peptide and if it is possible to detection by commercial his-tag ELISA?

A:
Thanks for your question! Our protein contains the his-tag, so it can be used in his-tag Elisa in theory. But we have not verified it by ourself yet, so we can't gurantee.
Customer Reviews

Related Products

GCG Antibodies

GCG Antibodies for Human

GCG Antibodies for Homo sapiens (Human)

GCG Proteins

GCG Proteins for Homo sapiens (Human)

GCG ELISA Kit

GCG ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.