Recombinant Human Prostaglandin E synthase 3 (PTGES3)

Code CSB-YP613587HU
Abbreviation Recombinant Human PTGES3 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
metabolism
Alternative Names
Cytosolic prostaglandin E2 synthase Short name: cPGES Hsp90 co-chaperone Progesterone receptor complex p23 Telomerase-binding protein p23
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-160aa
Target Protein Sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.7 kDa
Protein Length
Full length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
25-35 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.
Gene References into Functions
  1. The Hsp90 independence of the interaction between p23 and p53 DNA-binding domain, together with the competition of p23 versus DNA for p53, raises the intriguing possibility that p23, like other small charged proteins, may affect p53 in hitherto unknown ways. PMID: 29334217
  2. dysregulation of GR, MR, FKBP5, and PTGES3 in autistic spectrum disorder (ASD) and suggest a possible role of inflammation in altered GR function in ASD. PMID: 25912394
  3. increased p23 expression may allow cells to acquire a more aggressive phenotype, contributing to disease progression PMID: 25241147
  4. Even if p23 predominantly binds the Hsp90 dimer, p23 is also able to interact with Hsp90 oligomers, shifting the Hsp90 dimer-oligomers equilibrium toward dimer. PMID: 26151834
  5. FKBP4, p23, and Aha1 cooperatively regulate the progression of hAgo2 through the chaperone cycle. PMID: 23741051
  6. p23 recruits PHD2 to the HSP90 machinery to facilitate HIF-1alpha hydroxylation PMID: 23413029
  7. The effects of p23 on androgen receptor (AR) activity are at least partly HSP90 independent, a mutant form of p23, unable to bind HSP90, increases AR activity. PMID: 22899854
  8. p23 co-chaperone protects the aryl hydrocarbon receptor from degradation PMID: 22759865
  9. As an anti-apoptotic factor, p23 is able to be a potential target for anti-leukemic therapy. PMID: 22677230
  10. Patients with severe Alzheimer disease displayed a consistent reduction in brain p23 levels. Cleavage product p19 was not seen in AD brain samples. PMID: 21691801
  11. a small increase in the expression of p23 amplifies ER-binding genome wide and, in combination with ER, elicits an invasive phenotype in breast cancer PMID: 22074947
  12. In cytosol only one protein called p23 hsp90 binds to Bax but the binding protein does not affect the subcellular localization and pro-apoptotic activity of Bax. PMID: 22277657
  13. Data show that cytosolic prostaglandin E synthase 2 is found in microglia, neurons, and endothelium of control human middle frontal gyrus and that its levels decrease in pyramidal cells of Alzheimer's disease brains. PMID: 19001348
  14. The p23 cochaperone of Hsp90, which plays a major role in glucocorticoid receptor folding and function, associates with influenza virus polymerase. PMID: 21853119
  15. the N-terminal domain of human Hsp90 triggers binding to the cochaperone p23 PMID: 21183720
  16. High levels of Hsp90 cochaperone p23 promote tumor progression in breast cancer by increasing lymph node metastases and drug resistance. PMID: 20847343
  17. the interaction of the Hsp90-p23 complex with hTERT is critical for regulation of the nuclear localization of telomerase PMID: 19751963
  18. Data show that the small molecule celastrol inhibits the Hsp90 chaperoning machinery by inactivating the co-chaperone p23, resulting in a more selective destabilization of steroid receptors. PMID: 19996313
  19. localizes in vivo to genomic response elements in a hormone-dependent manner, disrupting receptor-mediated transcriptional activation in vivo and in vitro PMID: 12077419
  20. TEP1, hTR, hsp90, p23, and dyskerin remained at high and unchanged levels throughout up- or down regulation of telomerase activity. PMID: 12135483
  21. acts in vivo to stabilize hsp90 binding to client protein [hsp90 cochaperone p23] PMID: 14507910
  22. A role proposed for co-chaperone p23 is to lock individual subunits of Hsp90 in an ATP-dependent conformational state that has a high affinity for client proteins. PMID: 16403413
  23. p23 differentially regulates ER target genes and is involved in the control of distinct cellular processes in breast tumor development PMID: 16809759
  24. Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles. PMID: 17697149
  25. all three terminal prostaglandin synthases, mPGES-1, mPGES-2, and cPGES, are over-expressed in human gliomas PMID: 19347995
  26. Overexpression of Delta p23 resulted in a decrease in hTERT levels, and a down-regulation in telomerase activity. PMID: 19740745

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
P23/wos2 family
Database Links

HGNC: 16049

OMIM: 607061

KEGG: hsa:10728

STRING: 9606.ENSP00000262033

UniGene: Hs.50425

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*