Recombinant Human Protein S100-A7A (S100A7A), partial

In Stock
Code CSB-YP771423HU
Abbreviation Recombinant Human S100A7A protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
S100A7A
Uniprot No.
Research Area
Cell Biology
Alternative Names
S100A7A; S100A15; S100A7L1; Protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7-like 1; S100 calcium-binding protein A7A
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
2-101aa
Target Protein Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.2kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human S100A7A protein production in Yeast cells involves the integration of a DNA fragment encoding the Human S100A7A protein (2-101aa) into a plasmid vector, which is then introduced into Yeast cells. Following screening, positive cells are cultured and induced to synthesize the S100A7A protein. A N-terminal 6xHis tag is attached to the protein. Cell lysis is carried out to harvest the recombinant Human S100A7A protein, which is purified through affinity purification and then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human S100A7A protein reaches over 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
Gene References into Functions
  1. S100A15 retains the ability to coordinate zinc through incorporation of an exogenous ligand resulting in a unique zinc-binding site among S100 proteins. PMID: 22747601
  2. Molecular cloning and characterization of alternatively spliced S100A15 isoforms from psoriatic skin. PMID: 12923069
  3. The S100A15 protein has been expressed & purified to homogeneity in 2 crystal forms. Crystals of form I are triclinic. Crystals of form II are monoclinic & have a solvent content of 51.8%, corresponding to the presence of 1 monomer in the asymmetric unit. PMID: 16682778
  4. Overexpression of hS100A15 in chronic inflammatory skin diseases and regulation by inflammatory cytokines and calcium suggest that hS100A15 is involved in Th1-associated epithelial responses and epidermal maturation in normal and diseased human skin PMID: 17620096
  5. E. coli modulates S100A15 and IL-8 expression of keratinocytes by recognition through TLR4. PMID: 17625598
  6. study defines RAGE (receptor for advanced glycation end products) as the hS100A7 receptor, whereas hS100A15 functions through a Gi protein-coupled receptor PMID: 18606705

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
S-100 family
Tissue Specificity
Overexpressed in psoriasis.
Database Links

HGNC: 21657

OMIM: 617427

KEGG: hsa:338324

UniGene: Hs.442337

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*