Home
Protein
Recombinant Proteins
Recombinant Human Protein S100-A7A (S100A7A), partial

Recombinant Human Protein S100-A7A (S100A7A), partial

^{In Stock}

Code	CSB-YP771423HU
Abbreviation	Recombinant Human S100A7A protein, partial
MSDS	MSDS Datasheet
Size	$276
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

S100A7A

Uniprot No.

Q86SG5

Research Area

Cell Biology

Alternative Names

S100A7A; S100A15; S100A7L1; Protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7-like 1; S100 calcium-binding protein A7A

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

2-101aa

Target Protein Sequence

SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.2kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human S100A7A protein production in Yeast cells involves the integration of a DNA fragment encoding the Human S100A7A protein (2-101aa) into a plasmid vector, which is then introduced into Yeast cells. Following screening, positive cells are cultured and induced to synthesize the S100A7A protein. A N-terminal 6xHis tag is attached to the protein. Cell lysis is carried out to harvest the recombinant Human S100A7A protein, which is purified through affinity purification and then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human S100A7A protein reaches over 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.

Gene References into Functions

S100A15 retains the ability to coordinate zinc through incorporation of an exogenous ligand resulting in a unique zinc-binding site among S100 proteins. PMID: 22747601
Molecular cloning and characterization of alternatively spliced S100A15 isoforms from psoriatic skin. PMID: 12923069
The S100A15 protein has been expressed & purified to homogeneity in 2 crystal forms. Crystals of form I are triclinic. Crystals of form II are monoclinic & have a solvent content of 51.8%, corresponding to the presence of 1 monomer in the asymmetric unit. PMID: 16682778
Overexpression of hS100A15 in chronic inflammatory skin diseases and regulation by inflammatory cytokines and calcium suggest that hS100A15 is involved in Th1-associated epithelial responses and epidermal maturation in normal and diseased human skin PMID: 17620096
E. coli modulates S100A15 and IL-8 expression of keratinocytes by recognition through TLR4. PMID: 17625598
study defines RAGE (receptor for advanced glycation end products) as the hS100A7 receptor, whereas hS100A15 functions through a Gi protein-coupled receptor PMID: 18606705