Recombinant Human Protein delta homolog 1(DLK1),partial

Code CSB-YP006945HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P80370
Relevance May have a role in neuroendocrine differentiation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias pG2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Research Area Neuroscience
Source Yeast
Gene Names DLK1
Protein Names Recommended name: Protein delta homolog 1 Short name= DLK-1Alternative name(s): pG2Cleaved into the following chain: 1. Fetal antigen 1 Short name= 2. FA1
Expression Region 24-303aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 31.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May have a role in neuroendocrine differentiation.
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendo
Database Links

HGNC: 2907

OMIM: 176290

KEGG: hsa:8788

STRING: 9606.ENSP00000340292

UniGene: Hs.116631

Related Products

DLK1 Antibodies

DLK1 Antibodies for Homo sapiens (Human)

DLK1 Antibodies for Human

DLK1 Proteins

DLK1 Proteins for Homo sapiens (Human)

DLK1 ELISA Kit

DLK1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.