Recombinant Human Protein delta homolog 1(DLK1),partial

Code CSB-YP006945HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names DLK1
Uniprot No. P80370
Research Area Neuroscience
Alternative Names Adipocyte differentiation inhibitor protein; Brevideltin; Delta like 1 homolog; Delta like homolog; Delta like protein; Delta1; DLK 1; DLK; DLK-1; DLK1; DLK1_HUMAN; FA 1; FA1; Fetal antigen 1; pG2; Preadipocyte factor 1; Pref 1; Pref; Pref1; Protein delta homolog 1; Secredeltin; ZOG
Species Homo sapiens (Human)
Source Yeast
Expression Region 24-303aa
Target Protein Sequence AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 31.8kDa
Protein Length partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May have a role in neuroendocrine differentiation.
Gene References into Functions
  1. Data suggest that targeted methylation of MEG3-DMRs (differentially methylated regions) is sufficient to repress DLK1-MEG3 locus and increase beta-cell susceptibility to cytokines; this study provides evidence for role of novel enhancer in regulation of imprinting at DLK1-MEG3 locus in beta-cells of subjects with type 2 diabetes . (MEG3 = MEG3 non-coding RNA; DLK1 = delta-like 1 protein) PMID: 30084829
  2. We conclude methylation changes at some CpG sites of MEST and DLK differentially methylated regions in preeclamptic group PMID: 29157033
  3. point mutations in DLK1 and KCNK9 at least do not seem to be a common cause of central precocious puberty in girls. PMID: 28672280
  4. The expression of piRNAs encoded at DLK1-DIO3 enhances the prognostic potential of small non-coding RNAs specific to this locus in predicting lung cancer patient outcome. PMID: 27829231
  5. targeting DLK1 might inhibit the tumor growth via initiating cell differentiation of hepatocellular carcinoma (HCC) cancer stem cell. PMID: 27683116
  6. SASH1 acts through NOTCH1 and its inhibitor DLK1 in a three-dimensional model of lumenogenesis involving CEACAM1. PMID: 28823832
  7. The data presented in this work suggest that a fine regulation of NOTCH signaling BY DLK1 plays an important role in the control of breast cancer cell proliferation and invasion. PMID: 28461338
  8. results demonstrate that miR-129-5p inhibits non-small cell lung cancer stemness and chemoresistance through direct targeting of DLK1 PMID: 28619508
  9. A complex defect of DLK1 ( approximately 14-kb deletion and 269-bp duplication) was identified in a family with central precocious puberty. This deletion included the 5' untranslated region and the first exon of DLK1, including the translational start site. Only family members who inherited the defect from their father have precocious puberty, consistent with the known imprinting of DLK1. PMID: 28324015
  10. Loss of DLK1 expression is associated with fetal growth retardation complications of pregnancy. PMID: 27776119
  11. In neonatal skin, DLK1 exhibited a high degree of monoallelic expression from the paternal allele. PMID: 27329732
  12. The study evaluated the roles of extracellular soluble DLK1, comprising six EGF-like domains and juxtamembrane regions, in human pancreatic cancer MIA PaCa-2 cells in vitro and in vivo. Soluble DLK1 exerted antitumor effects not only in cancer cell migration and anchorage-independent cell growth but also in in vivo tumor growth. PMID: 27191393
  13. Treatment of mice with recombinant human DLK1 during pregnancy has significant effects on AT of the offspring. This can be associated with counter-regulatory changes in the Notch1 signaling cascade. PMID: 26499442
  14. NOTCH1 ligand Delta-like 1 homolog (DLK1) self interacts PMID: 28099888
  15. Pref-1 induces insulin synthesis and secretion via two independent pathways PMID: 27044861
  16. Data from longitudinal, nested case-control study conducted in rural South Korea suggest that low serum levels of DLK1 (preadipocyte factor 1) may be useful biomarker for identifying women (but not men) at high risk of developing insulin resistance, prediabetes, and type 2 diabetes. PMID: 26220259
  17. The appropriate timing of Dll1 expression is critical for its oscillatory expression, pointing to the functional significance of Dll1-mediated oscillatory cell-cell interactions in the segmentation clock. [review] PMID: 26818178
  18. Results suggest a potential signalling hierarchy between Delta-like 1 and ephrin-B2 ligands, as neural stem cells adopt the Delta-like 1 phenotype of stem cell maintenance on simultaneous presentation of both signals. PMID: 26754526
  19. The results indicate the occurrence of epimutation affecting the IG-DMR and the MEG3-DMR in the two cases, and imply that UPD(14)mat and related (epi)genetic aberrations constitute a rare but important underlying factor for Silver-Russell Syndrome PMID: 25351781
  20. Kaplan-Meier analysis indicated that higher DLK1 levels were associated with shorter survival in Hepatocellular carcinoma (HCC) patients. These results suggest that the serum levels of DLK1 may serve as a prognostic biomarker for HCC patients. PMID: 26018510
  21. Notch pathway activation in endothelial colony forming cells in vivo via co-implanted stromal cells expressing delta-like 1 promotes vasculogenesis. PMID: 25559145
  22. Data show that the median expression of Jagged-1 protein and delta-like 1 protein (Dll-1) was significantly higher in acute myeloid leukemia (AML) blasts than in peripheral blood stem cells (PBSCs). PMID: 24844362
  23. DLK1 expression diminishes during differentiation of human U937 cells to macrophages. PMID: 26115479
  24. Differentiation was comparatively weighted toward the second peak in Delta1 pre-expanded cells. PMID: 23831361
  25. Data show that preadipocyte factor 1 Pref-1 is probably not a major contributor to gestational diabetes mellitus (GDM) pathophysiology but might directly contribute to triglycerides (TG) metabolism, as well as depend on gestational age and renal function. PMID: 25461394
  26. These mice show improved glucose tolerance. Taken together, we conclude Pref-1 as a positive regulator of islet beta-cells and insulin production. PMID: 25918019
  27. Serum levels of Pref-1 were associated with the amount of alcohol consumed during the past 30 days. PMID: 25449367
  28. DLK1 can promote the invasion of lung cancer cells by upregulating MMP9 expression, which depends on Notch signaling PMID: 24621612
  29. DLK1, INSL3 and COUP-TFII expression changes during normal development and is linked to different stages of Leydig Cell differentiation. PMID: 24908673
  30. the microRNA cluster at the Dlk1-Dio3 locus is upregulated in lung adenocarcinoma PMID: 24317514
  31. Pregnancies complicated by gestational diabetes mellitus have decreased fetal pref-1 concentrations compared to normal pregnancies PMID: 24518358
  32. In particular, a locus on chromosome 6 comprises a well-known cluster of imprinted genes including the paternally expressed Dlk1, an atypical Notch ligand PMID: 24676147
  33. DLK1 interacts with the PHB1-PHB2 complex via its cytoplasmic domain and regulates mitochondrial functions, including mitochondrial membrane potential and production of reactive oxygen species. PMID: 24249679
  34. Overall, the data suggest that active expression of the DLK1-DIO3 cluster represents a new biomarker for epigenetic stability of hESCs and indicates the importance of using a proper physiological oxygen level during the derivation and culture of hESCs. PMID: 24123616
  35. We found that, while embryonal rhabdomyosarcomas tumors consistently show LOI of the differentially methylated regions at the DLK1-GTL2 locus, alveolar rhabdomyosarcomas tumors have erasure of imprinting (EOI) at this locus. PMID: 24173021
  36. the imprinted DLK1-DIO3 locus is regulated by noncoding RNA IPW in an induced pluripotent stem cell model of Prader-Willi syndrome PMID: 24816254
  37. These results support a role for microRNAs of DLK1-MEG3 cluster and their epigenetic control by DNA methylation in the pathogenesis of type 2 diabetes mellitus. PMID: 24374217
  38. Elevated Pref-1 concentrations in type 2 diabetes mellitus (T2DM) subjects may contribute to impaired adipose tissue differentiation capacity associated with insulin resistance in obese patients with T2DM. PMID: 23979788
  39. Pref-1 have differential effects on bone mineral density and strength parameters in adolescent athletes compared with non-athletes PMID: 23579340
  40. Dlk1 is a candidate marker for skeletal muscle tumors PMID: 23577150
  41. Primary prostatic cancer-associated fibroblasts (CAFs) were isolated and the expression of CAF markers, Dlk1 and SCUBE1 transcripts were characterised. PMID: 23136397
  42. Placental Pref-1 expression in SGA fetuses was decreased and associated with postnatal body weight, suggesting a role of Pref-1 in the regulation of postnatal development. PMID: 23410724
  43. Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages. PMID: 23415968
  44. that alterations in Pref-1 are not involved in the ethiopathogenesis of anorexia nervosa but its changes after partial realimentation could be involved in the regulation of adipose tissue expansion after realimentation. PMID: 22292722
  45. The mRNA expression of TET2 in CD(3)(+) T cells of myelodysplastic syndrome patients was decreased while the mRNA expression of DLK1 was increased. PMID: 22943828
  46. Loss of methylation at the DLK1-MEG3 locus correlates linearly with global loss of DNA methylation in human hepatocellular carcinoma. PMID: 23145177
  47. Reviewed are the microRNAs within the DLK1-DIO3 genomic region, their role in controlling tissue homeostasis and in the pathogenesis of some human diseases, mostly cancer, when aberrantly expressed. [review] PMID: 22825660
  48. DLK1 mRNA levels are higher in MDS patients and lower in AML patients than in healthy individuals. PMID: 22513084
  49. Dlk may regulate the endothelial function in neuroblastic tumors. PMID: 15605081
  50. Delta-like protein seems to be a highly sensitive and specific marker for hepatoblastomas. PMID: 18236070
  51. Pref-1 may have differential effects in states of nutritional deprivation compared with nutritional sufficiency. PMID: 22508185
  52. A regulatory role for DLK1 in human and mouse neural progenitor differentiation and an interaction between DLK1 and Hes1-mediated Notch signaling in these cells, are reported. PMID: 21761283
  53. Data suggest that DLK1 could be a potential therapeutic target against the hepatocellular carcinoma (HCC) stem/progenitor cells. PMID: 22238367
  54. Young women with brown adipose tissue (BAT) have higher bone mineral density and lower serum Pref-1 compared with women without BAT. PMID: 22259053
  55. The DLK1-MEG3 locus plays a tumor suppressor role in human nonfunctioning adenomas. PMID: 21871428
  56. coordinate up-regulation of the DLK1-DIO3 miRNA cluster at 14q32.2 may define a novel molecular (stem cell-like) subtype of hepatocellular carcinoma associated with poor prognosis PMID: 21737452
  57. mRNA expressions of DLK1, c-FLIPL and c-FLIPS are abnormal in bone marrow mononuclear cells of myelodysplastic syndrome patients. PMID: 20561424
  58. Adipose tissue in metabolically healthy obese individuals had lower levels of Pref-1, a known inhibitor of preadipocyte differentiation, and a more favorable inflammatory profile. PMID: 21252254
  59. DLK1 gene may be involved in leukemia, but the mRNA level of DLK1 has no relation with some clinical characteristics of AL patients at onset. PMID: 19779261
  60. dlk1's expression in non-small cell lung cancers PMID: 20959062
  61. Constitutive overexpression of DLK-1/PREF1 in CB MSC resulted in a reduced adipogenic differentiation, whereas silencing of DLK-1 in USSC resulted in adipogenic differentiation. PMID: 20331358
  62. DLK1 gene is imprinted, with preferential expression from the paternal allele. PMID: 11076856
  63. hDlk-1 is a cell surface protein expressed in many carcinomas. PMID: 20356822
  64. IFI16 may be an essential downstream target of DLK1 in hepatocellular carcinomas (HCC) cells and required for DLK1-induced cell proliferation. PMID: 20214740
  65. An insulator located 18 kb upstream of DLK1 plays an important role in regulating DLK1 imprinting. PMID: 20089961
  66. Studies indicate the imprinted DLK1-MEG3 gene region of chromosome 14q32.2 contains a functional T1D candidate gene. PMID: 19966805
  67. The imprinted DLK1-MEG3 gene region of chromosome 14q32.2 is robustly associated with paternally inherited risk of type 1 diabetes. DLK1 is the most likely functional T1D candidate gene in the region. PMID: 19966805
  68. identified dlk1/FA1 as a novel marker of chondroprogenitor cells that undergo embryonic lineage progression from proliferation to the prehypertrophic stage. PMID: 20058200
  69. Pref-1 has roles in adipogenesis and mesenchymal cell fate [review] PMID: 19541743
  70. designed allele-specific methylation study of the DLK1/GTL2 intergenic differentially methylated region allowed us to determine the parental origin of del(14q/IGH) in 9/20 analyzed cases. PMID: 19786834
  71. Retroviral mediated expression of the human myeloid nuclear antigen in a null cell line upregulates Dlk1 expression PMID: 12112016
  72. delta-like 1 expression in a subset of neuroblastoma cell lines corresponds to a differentiated chromaffin cell type PMID: 12672031
  73. The mRNA expression level of the gene delta-like (Dlk) was measured using real-time PCR methodology in a large series of control biopsies and bone marrow trephines from patients with myelodysplastic syndrome and related myeloid disorders. PMID: 15289021
  74. DLK1 has activity both as a soluble and a transmembrane expressed protein PMID: 15806146
  75. Dlk1 is overexpressed in selected samples of MDS (especially RA and RAEB) and AML (particularly M6, M7), and it appears to be associated with normal development of megakaryocytes and B cells. PMID: 15959531
  76. results suggest that DLK1 may play a role in the formation or progression of gliomas PMID: 16288219
  77. DLK1 variants in pituitary- and neuroendocrine tumors include Secredeltin, Brevideltin and Brevideltinin PMID: 16403460
  78. The regulation of expression, not splicing, is the most likely mechanism controlling the biological function of DLK1. PMID: 16901742
  79. role for Dlk1 in regulating the multiple biological functions of hMSC by influencing the composition of their microenvironment "niche." PMID: 17182623
  80. the maternal UPD14 phenotype is due to aberrant gene expression within the imprinted domain at 14q32 PMID: 17601927
  81. Monitoring dlk1 levels may be important to evaluate the metabolic and hormonal stage of child development. PMID: 18248640
  82. DLK1 was expressed in liver neoplasms. DLK1-positive patients had a shorter survival time than DLK1-negative patients. Cox regression analysis also showed that DLK1 is a risk factor. PMID: 18352842
  83. the novel prostate progenitor marker Dlk-1 is downregulated by Notch signalling in intermediate cells. The identification of Dlk-1-expressing candidate stem and neuroendocrine cells suggests a hierarchical relationship PMID: 18375047
  84. Associated with extreme early-onset obesity. PMID: 18398438
  85. four patients with clinical features of upd(14)mat who show a maternal-only methylation pattern, but biparental inheritance for chromosome 14. PMID: 18454453
  86. The expression of Dlk1 was found to be up-regulated in CD34+ cells from patients with myelodysplastic syndrome (MDS) by analyzing the gene expression profiles determined by microarray. PMID: 18575777
  87. Selective loss of MEG3 expression and intergenic differentially methylated region hypermethylation in the MEG3/DLK1 locus in human clinically nonfunctioning pituitary adenomas. PMID: 18628527
  88. Pref-1 is modulated by both dexamethasone and 3-isobutyl-1methylxanthine (IBMX), two components of the adipogenic induction mixture during the adipogenesis in vitro. PMID: 19427405
  89. PTTG1 and DLK1 are involved in cell differentiation and transformation. PMID: 19477929
  90. DLK is a novel immunohistochemical marker for adrenal gland tumors. PMID: 19685073
  91. Because elevated DLK1 expression is found in many tumor types, our observations suggest that hypoxia and DLK1 may constitute an important stem cell pathway for the regulation of cancer stem cell-like functionality and tumorigenicity. PMID: 19934310

Show More

Hide All

Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendo
Database Links

HGNC: 2907

OMIM: 176290

KEGG: hsa:8788

STRING: 9606.ENSP00000340292

UniGene: Hs.116631

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1