Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

DLK1

Uniprot No.

P80370

Research Area

Neuroscience

Alternative Names

Adipocyte differentiation inhibitor protein; Brevideltin; Delta like 1 homolog; Delta like homolog; Delta like protein; Delta1; DLK 1; DLK; DLK-1; DLK1; DLK1_HUMAN; FA 1; FA1; Fetal antigen 1; pG2; Preadipocyte factor 1; Pref 1; Pref; Pref1; Protein delta homolog 1; Secredeltin; ZOG

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

24-303aa

Target Protein Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.8 kDa

Protein Length

Partial

Tag Info

C-terminal Flag-Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human Protein Delta Homolog 1 (DLK1) is a valuable addition to your neuroscience research toolbox. DLK1, also known as DLK-1 or pG2, is a transmembrane protein that plays a crucial role in the development and differentiation of various cell types, particularly in the nervous system. Studies have implicated DLK1 in numerous biological processes, including neurogenesis, adipogenesis, and cell fate determination.

Our Recombinant Human DLK1 protein is produced in a mammalian cell system, ensuring proper folding and post-translational modifications. The protein consists of a partial sequence (24-303aa) and is fused with a C-terminal Flag-Myc tag for efficient purification and detection. With a purity of greater than 90% as determined by SDS-PAGE, our DLK1 protein guarantees consistent performance in your experiments. Available in both liquid and lyophilized powder forms, this high-quality protein is designed to meet the diverse demands of your neuroscience research.

Target Background

Function

May have a role in neuroendocrine differentiation.

Gene References into Functions

Data suggest that targeted methylation of MEG3-DMRs (differentially methylated regions) is sufficient to repress DLK1-MEG3 locus and increase beta-cell susceptibility to cytokines; this study provides evidence for role of novel enhancer in regulation of imprinting at DLK1-MEG3 locus in beta-cells of subjects with type 2 diabetes . (MEG3 = MEG3 non-coding RNA; DLK1 = delta-like 1 protein) PMID: 30084829
We conclude methylation changes at some CpG sites of MEST and DLK differentially methylated regions in preeclamptic group PMID: 29157033
point mutations in DLK1 and KCNK9 at least do not seem to be a common cause of central precocious puberty in girls. PMID: 28672280
The expression of piRNAs encoded at DLK1-DIO3 enhances the prognostic potential of small non-coding RNAs specific to this locus in predicting lung cancer patient outcome. PMID: 27829231
targeting DLK1 might inhibit the tumor growth via initiating cell differentiation of hepatocellular carcinoma (HCC) cancer stem cell. PMID: 27683116
SASH1 acts through NOTCH1 and its inhibitor DLK1 in a three-dimensional model of lumenogenesis involving CEACAM1. PMID: 28823832
The data presented in this work suggest that a fine regulation of NOTCH signaling BY DLK1 plays an important role in the control of breast cancer cell proliferation and invasion. PMID: 28461338
results demonstrate that miR-129-5p inhibits non-small cell lung cancer stemness and chemoresistance through direct targeting of DLK1 PMID: 28619508
A complex defect of DLK1 ( approximately 14-kb deletion and 269-bp duplication) was identified in a family with central precocious puberty. This deletion included the 5' untranslated region and the first exon of DLK1, including the translational start site. Only family members who inherited the defect from their father have precocious puberty, consistent with the known imprinting of DLK1. PMID: 28324015
Loss of DLK1 expression is associated with fetal growth retardation complications of pregnancy. PMID: 27776119
In neonatal skin, DLK1 exhibited a high degree of monoallelic expression from the paternal allele. PMID: 27329732
The study evaluated the roles of extracellular soluble DLK1, comprising six EGF-like domains and juxtamembrane regions, in human pancreatic cancer MIA PaCa-2 cells in vitro and in vivo. Soluble DLK1 exerted antitumor effects not only in cancer cell migration and anchorage-independent cell growth but also in in vivo tumor growth. PMID: 27191393
Treatment of mice with recombinant human DLK1 during pregnancy has significant effects on AT of the offspring. This can be associated with counter-regulatory changes in the Notch1 signaling cascade. PMID: 26499442
NOTCH1 ligand Delta-like 1 homolog (DLK1) self interacts PMID: 28099888
Pref-1 induces insulin synthesis and secretion via two independent pathways PMID: 27044861
Data from longitudinal, nested case-control study conducted in rural South Korea suggest that low serum levels of DLK1 (preadipocyte factor 1) may be useful biomarker for identifying women (but not men) at high risk of developing insulin resistance, prediabetes, and type 2 diabetes. PMID: 26220259
The appropriate timing of Dll1 expression is critical for its oscillatory expression, pointing to the functional significance of Dll1-mediated oscillatory cell-cell interactions in the segmentation clock. [review] PMID: 26818178
Results suggest a potential signalling hierarchy between Delta-like 1 and ephrin-B2 ligands, as neural stem cells adopt the Delta-like 1 phenotype of stem cell maintenance on simultaneous presentation of both signals. PMID: 26754526
The results indicate the occurrence of epimutation affecting the IG-DMR and the MEG3-DMR in the two cases, and imply that UPD(14)mat and related (epi)genetic aberrations constitute a rare but important underlying factor for Silver-Russell Syndrome PMID: 25351781
Kaplan-Meier analysis indicated that higher DLK1 levels were associated with shorter survival in Hepatocellular carcinoma (HCC) patients. These results suggest that the serum levels of DLK1 may serve as a prognostic biomarker for HCC patients. PMID: 26018510
Notch pathway activation in endothelial colony forming cells in vivo via co-implanted stromal cells expressing delta-like 1 promotes vasculogenesis. PMID: 25559145
Data show that the median expression of Jagged-1 protein and delta-like 1 protein (Dll-1) was significantly higher in acute myeloid leukemia (AML) blasts than in peripheral blood stem cells (PBSCs). PMID: 24844362
DLK1 expression diminishes during differentiation of human U937 cells to macrophages. PMID: 26115479
Differentiation was comparatively weighted toward the second peak in Delta1 pre-expanded cells. PMID: 23831361
Data show that preadipocyte factor 1 Pref-1 is probably not a major contributor to gestational diabetes mellitus (GDM) pathophysiology but might directly contribute to triglycerides (TG) metabolism, as well as depend on gestational age and renal function. PMID: 25461394
These mice show improved glucose tolerance. Taken together, we conclude Pref-1 as a positive regulator of islet beta-cells and insulin production. PMID: 25918019
Serum levels of Pref-1 were associated with the amount of alcohol consumed during the past 30 days. PMID: 25449367
DLK1 can promote the invasion of lung cancer cells by upregulating MMP9 expression, which depends on Notch signaling PMID: 24621612
DLK1, INSL3 and COUP-TFII expression changes during normal development and is linked to different stages of Leydig Cell differentiation. PMID: 24908673
the microRNA cluster at the Dlk1-Dio3 locus is upregulated in lung adenocarcinoma PMID: 24317514
Pregnancies complicated by gestational diabetes mellitus have decreased fetal pref-1 concentrations compared to normal pregnancies PMID: 24518358
In particular, a locus on chromosome 6 comprises a well-known cluster of imprinted genes including the paternally expressed Dlk1, an atypical Notch ligand PMID: 24676147
DLK1 interacts with the PHB1-PHB2 complex via its cytoplasmic domain and regulates mitochondrial functions, including mitochondrial membrane potential and production of reactive oxygen species. PMID: 24249679
Overall, the data suggest that active expression of the DLK1-DIO3 cluster represents a new biomarker for epigenetic stability of hESCs and indicates the importance of using a proper physiological oxygen level during the derivation and culture of hESCs. PMID: 24123616
We found that, while embryonal rhabdomyosarcomas tumors consistently show LOI of the differentially methylated regions at the DLK1-GTL2 locus, alveolar rhabdomyosarcomas tumors have erasure of imprinting (EOI) at this locus. PMID: 24173021
the imprinted DLK1-DIO3 locus is regulated by noncoding RNA IPW in an induced pluripotent stem cell model of Prader-Willi syndrome PMID: 24816254
These results support a role for microRNAs of DLK1-MEG3 cluster and their epigenetic control by DNA methylation in the pathogenesis of type 2 diabetes mellitus. PMID: 24374217
Elevated Pref-1 concentrations in type 2 diabetes mellitus (T2DM) subjects may contribute to impaired adipose tissue differentiation capacity associated with insulin resistance in obese patients with T2DM. PMID: 23979788
Pref-1 have differential effects on bone mineral density and strength parameters in adolescent athletes compared with non-athletes PMID: 23579340
Dlk1 is a candidate marker for skeletal muscle tumors PMID: 23577150
Primary prostatic cancer-associated fibroblasts (CAFs) were isolated and the expression of CAF markers, Dlk1 and SCUBE1 transcripts were characterised. PMID: 23136397
Placental Pref-1 expression in SGA fetuses was decreased and associated with postnatal body weight, suggesting a role of Pref-1 in the regulation of postnatal development. PMID: 23410724
Paternal methylation aberrations at imprinting control regions of DLK1-GTL2, MEST (PEG1), and ZAC (PLAGL1) and global methylation levels are not associated with idiopathic recurrent spontaneous miscarriages. PMID: 23415968
that alterations in Pref-1 are not involved in the ethiopathogenesis of anorexia nervosa but its changes after partial realimentation could be involved in the regulation of adipose tissue expansion after realimentation. PMID: 22292722
The mRNA expression of TET2 in CD(3)(+) T cells of myelodysplastic syndrome patients was decreased while the mRNA expression of DLK1 was increased. PMID: 22943828
Loss of methylation at the DLK1-MEG3 locus correlates linearly with global loss of DNA methylation in human hepatocellular carcinoma. PMID: 23145177
Reviewed are the microRNAs within the DLK1-DIO3 genomic region, their role in controlling tissue homeostasis and in the pathogenesis of some human diseases, mostly cancer, when aberrantly expressed. [review] PMID: 22825660
DLK1 mRNA levels are higher in MDS patients and lower in AML patients than in healthy individuals. PMID: 22513084
Dlk may regulate the endothelial function in neuroblastic tumors. PMID: 15605081
Delta-like protein seems to be a highly sensitive and specific marker for hepatoblastomas. PMID: 18236070

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein. Cytoplasm.

Tissue Specificity

Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in some forms of neuroendo

Database Links

HGNC: 2907

OMIM: 176290

KEGG: hsa:8788

STRING: 9606.ENSP00000340292

UniGene: Hs.116631

Code	CSB-MP006945HU
Abbreviation	Recombinant Human DLK1 protein, partial
MSDS	MSDS Datasheet
Size	$156
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Protein delta homolog 1 (DLK1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage