Recombinant Human Ras-related C3 botulinum toxin substrate 3 (RAC3)

Code CSB-EP019249HU
Abbreviation Recombinant Human RAC3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
OTTMUSP00000004488; p21 Rac3; p21-Rac3; Rac1B; RAC3; RAC3_HUMAN; RAS related C3 botulinum substrate 3; Ras related C3 botulinum toxin substrate 3 (rho family small GTP binding protein Rac3) ; Ras related C3 botulinum toxin substrate 3 (rho family; small GTP binding protein Rac3); Ras-related C3 botulinum toxin substrate 3; Rho family small GTP binding protein Rac3; RP23-84C12.18
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-192aa
Target Protein Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
Gene References into Functions
  1. Rac3 regulates breast cancer invasion and metastasis by controlling adhesion and matrix degradation. PMID: 29061650
  2. Rac3 regulates the biological behaviors of lung adenocarcinoma through a mechanism of downregulating CCND1, MYC, and TFDP1 of cell cycle pathway. PMID: 27402308
  3. Efficient silencing of Rac3 strongly inhibited A549 cell proliferation. PMID: 25854406
  4. Collectively these data unveil that FBXL19 functions as an antagonist of Rac3 by regulating its stability and regulates the TGFbeta1-induced E-cadherin down-regulation. PMID: 24684802
  5. Report role of Rac3 in breast cancer aggressiveness and show the potential usefulness of Rac3 depletion in breast cancer therapy. PMID: 23388133
  6. Rac1b forms a complex with NADPH oxidase and promotes the production of reactive oxygen species, expression of Snail, and activation of the epithelial-mesenchymal transition program. PMID: 22918955
  7. Activation of epithelial-mesenchymal transition by MMP-induced expression of Rac1b gave rise to lung adenocarcinoma. PMID: 22786680
  8. Rac3 GTPase has a role in the regulation of autophagy PMID: 21852230
  9. RAC3 is a novel ERalpha co-activator that promotes cell migration and has prognostic value for ERalpha-positive breast cancer metastasis. PMID: 21217774
  10. Our data is the first report of the frequency of Rac3 overexpression and mutation in human brain tumors. Overexpression may be associated with aggressive tumor behavior PMID: 15993075
  11. RAC1 and RAC3 have opposing functions in cell adhesion and differentiation in neuronal cells. PMID: 17244648
  12. Data demonstrate that Rac3 shares with Rac1 the ability to interfere with cadherin-mediated adhesion. PMID: 18319303
  13. Rac3 inhibits adhesion and differentiation of neuronal cells by modifying GIT1 downstream signaling. PMID: 19494130

Show More

Hide All

Subcellular Location
Cytoplasm. Endomembrane system. Cell projection, lamellipodium. Cytoplasm, perinuclear region. Cell membrane. Cytoplasm, cytoskeleton. Note=Membrane-associated when activated. Colocalizes with NRBP to endomembranes and at the cell periphery in lamellipodia. Colocalized with CIB1 in the perinuclear area and at the cell periphery.
Protein Families
Small GTPase superfamily, Rho family
Tissue Specificity
Highest levels in brain, also detected in heart, placenta and pancreas.
Database Links

HGNC: 9803

OMIM: 602050

KEGG: hsa:5881

STRING: 9606.ENSP00000304283

UniGene: Hs.45002

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*