Recombinant Human Ras-related C3 botulinum toxin substrate 3(RAC3)

Code CSB-EP019249HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P60763
Relevance Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias p21-Rac3
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
Research Area Signal Transduction
Source E.coli
Gene Names RAC3
Protein Names Recommended name: Ras-related C3 botulinum toxin substrate 3 Alternative name(s): p21-Rac3
Expression Region 1-192aa
Tag Info N-terminal GST-tagged
Mol. Weight 48.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as cell spreading and the formation of actin-based protusions including lamellipodia and membrane ruffles. Promotes cell adhesion and spreading on fibrinogen in a CIB1 and alpha-IIb/beta3 integrin-mediated manner.
Subcellular Location Cytoplasm, Endomembrane system, Cell projection, lamellipodium, Cytoplasm, perinuclear region, Cell membrane, Cytoplasm, cytoskeleton
Protein Families Small GTPase superfamily, Rho family
Tissue Specificity Highest levels in brain, also detected in heart, placenta and pancreas.
Database Links

HGNC: 9803

OMIM: 602050

KEGG: hsa:5881

STRING: 9606.ENSP00000304283

UniGene: Hs.45002

Pathway cAMP signaling pathway
MAPK signaling pathway
VEGF signaling pathway
Wnt signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Adherens junction
MAPK Erk pathway
Ras signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Natural killer cell mediated cytotoxicity
Rap1 signaling pathway
Sphingolipid signaling pathway

Related Products

RAC3 Antibodies

RAC3 Antibodies for Homo sapiens (Human)

RAC3 Antibodies for Human

RAC3 Proteins

RAC3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.