Recombinant Human Ras-related protein Rab-18 (RAB18)

Code CSB-EP878835HU
Abbreviation Recombinant Human RAB18 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
AA959686; RAB18; RAB18 small GTPase; RAB18; member RAS oncogene family; RAB18_HUMAN; RAB18LI1; Ras related protein Rab 18; Ras-asssociated protein RAB18; Ras-related protein Rab-18; RP11-148B2.1; WARBM3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-206aa
Target Protein Sequence
MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for the localization of ZFYVE1 to lipid droplets and for its function in mediating the formation of endoplasmic reticulum-lipid droplets (ER-LD) contacts. Plays a role in apical endocytosis/recycling. Plays a key role in eye and brain development and neurodegeneration.
Gene References into Functions
  1. The authors found that the previously documented interaction between TRAPPII and COPI was also required for the recruitment of Rab18 to the lipid droplet. PMID: 28003315
  2. findings suggest that RAB18 rs3765133 polymorphism affects the development of specific brain regions, particularly the cerebellum, in healthy people. PMID: 24996981
  3. RAB18 is the direct target of miR-455-5p in gastric cancer. PMID: 27451075
  4. Warburg Micro syndrome is caused by RAB18 deficiency. PMID: 26063829
  5. These results suggest that Rab18 has an important role in viral assembly through the trafficking of the hepatitis C virus core protein to lipid droplets. PMID: 24997429
  6. High RAB18 expression is associated with glioma. PMID: 24477653
  7. Rab18-mediated membrane trafficking of FASN and NS3 facilitates dengue virus replication. PMID: 24696471
  8. Rab18 interacts with the HCV nonstructural protein NS5A. PMID: 23935497
  9. Hepatitis B virus X protein enhances proliferation of hepatoma cells through Rab18. PMID: 23471881
  10. Micro syndrome has been associated with causative mutations in three disease genes: RAB3GAP1, RAB3GAP2 and RAB18. Martsolf syndrome has been associated with a mutation in RAB3GAP2. [Review] PMID: 23176487
  11. performed autozygosity mapping in five consanguineous families with Warburg micro syndrome without RAB3GAP1/2 mutations and identified loss-of-function mutations in RAB18 PMID: 21473985
  12. Rab18 regulates lipid droplet-associated membrane formation PMID: 15914536
  13. analysis of a novel splice variant of human Rab18 gene PMID: 16147880
  14. Rab18 is reduced in pituitary tumors causing acromegaly and its overexpression reverts growth hormone hypersecretion. PMID: 18349058
  15. Rab18 and Rab43 have key roles in ER-Golgi trafficking. PMID: 18664496
  16. Rab18 is recruited to lipid droplets during lipolysis PMID: 16207721

Show More

Hide All

Involvement in disease
Warburg micro syndrome 3 (WARBM3)
Subcellular Location
Apical cell membrane. Lipid droplet.
Protein Families
Small GTPase superfamily, Rab family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 14244

OMIM: 602207

KEGG: hsa:22931

STRING: 9606.ENSP00000349415

UniGene: Hs.406799

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*