Recombinant Human SPARC-related modular calcium-binding protein 1(SMOC1), partial

In Stock
Code CSB-EP875673HU1f0
Abbreviation Recombinant Human SMOC1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Secreted modular calcium-binding protein 1;SMOC-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
277-382aa
Target Protein Sequence
GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.2 kDa
Protein Length
Partial
Tag Info
C-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays essential roles in both eye and limb development. Probable regulator of osteoblast differentiation.
Gene References into Functions
  1. Missense mutation in exon 3 of SMOC1 segregated with the Waardenburg anophthalmia syndrome in the Iranian family. PMID: 28807869
  2. This is the first report of Waardenburg anophthalmia syndrome (WAS) caused by a SMOC1 variant in a Pakistani population. The mutation identified in the present investigation extends the body of evidence implicating the gene SMOC-1 in causing WAS. PMID: 28085523
  3. SMOC binds to Pro-EGF, but does not induce Erk phosphorylation via the EGFR. PMID: 27101391
  4. IL-17A but not IL-22 suppresses the replication of hepatitis B virus by inducing the expression of MxA and OAS. PMID: 23274784
  5. SMOC1 provides a link between prenatal hormone exposure and digit ratio. PMID: 23263445
  6. Homozygosity mapping and subsequent targeted mutation analysis of a locus on 14q24.2 identified homozygous mutations in SMOC1 (SPARC-related modular calcium binding 1) in eight unrelated families with Waardenburg Anophthalmia syndrome. PMID: 21750680
  7. The present study thus identified SPARC related modular calcium binding 1 as a new cancer-associated protein capable of interacting with tenascin-C in vitro PMID: 21349332
  8. these findings indicate that SMOC1/Smoc1 is essential for ocular and limb development in both humans and mice. PMID: 21194678
  9. Waardenburg anophthalmia syndrome is genetically heterogeneous; a second was locus found on chromosome 14, and mutations in SMOC1 were shown also cause this syndrome. PMID: 21194680
  10. Analyzed the secretory protein profiles of BMSCs grown in osteogenic medium (OSM) and identified SPARC-related modular calcium-binding protein 1 (SMOC1), a member of the SPARC family, as a regulator of osteoblast differentiation of BMSCs. PMID: 20359165
  11. isolation of the novel gene SMOC-1 encoding a secreted modular protein containing an EF-hand calcium-binding domain; localization within basement membranes in kidney and skeletal muscle and expression in the zona pellucida surrounding the oocyte PMID: 12130637
  12. SMOC-1 is of physiological interest because it codes a secreted glycoprotein with five domains, each containing regions homologous to those on other proteins that mediate cell-matrix interactions. PMID: 17386346

Show More

Hide All

Involvement in disease
Ophthalmoacromelic syndrome (OAS)
Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane. Note=In or around the basement membrane.
Tissue Specificity
Widely expressed in many tissues with a strongest signal in ovary. No expression in spleen.
Database Links

HGNC: 20318

OMIM: 206920

KEGG: hsa:64093

STRING: 9606.ENSP00000355110

UniGene: Hs.497349

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*