Recombinant Human Serine/threonine-protein kinase Nek9 (NEK9), partial

In Stock
Code CSB-EP837435HU
Abbreviation Recombinant Human NEK9 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Nercc1 kinase;Never in mitosis A-related kinase 9;NimA-related protein kinase 9;NimA-related kinase 8;Nek8
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
52-308aa
Target Protein Sequence
YIPIRVLGRGAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMDNTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTLNIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCVIFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTADELLDRPLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.5 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pleiotropic regulator of mitotic progression, participating in the control of spindle dynamics and chromosome separation. Phosphorylates different histones, myelin basic protein, beta-casein, and BICD2. Phosphorylates histone H3 on serine and threonine residues and beta-casein on serine residues. Important for G1/S transition and S phase progression. Phosphorylates NEK6 and NEK7 and stimulates their activity by releasing the autoinhibitory functions of Tyr-108 and Tyr-97 respectively.
Gene References into Functions
  1. High expression level of NEK9 is associated with recurrence in glioblastoma. PMID: 26956052
  2. Signaling cascade of the NIMA-related kinases (Neks) Nek6, Nek7, and Nek9 is required for the localization and function of two kinesins essential for cytokinesis, Mklp2 and Kif14 to properly coordinate cytokinesis. PMID: 28630147
  3. Recessive NEK9 mutation is associated with lethal skeletal dysplasia. PMID: 26908619
  4. Somatic Mutations in NEK9 Cause Nevus Comedonicus. PMID: 27153399
  5. Overall, these results highlight the complexity of virus-host interactions and identify a new role for the cellular protein Nek9 during human adenovirus infection, suggesting a role for Nek9 in regulating p53 target gene expression. PMID: 26676776
  6. The C-terminal domain of Nek9 activates Nek7 through promoting back-to-back dimerization. PMID: 26522158
  7. The findings demonstrate that a novel NEK9 network regulates the growth of cancer cells lacking functional p53. PMID: 25131192
  8. NEK9 inhibition represents a novel anti-cancer strategy by induction of mitotic catastrophe via impairment of spindle dynamics, cytokinesis and mitotic checkpoint control. PMID: 23665325
  9. Structural analysis of LC8 with both Nek9 peptides, together with different biophysical experiments, explains the observed diminished binding affinity of Nek9 to LC8 upon phosphorylation on Ser(944) within the Nek9 sequence PMID: 23482567
  10. Nek9 phosphorylates NEDD1 on Ser377 driving its recruitment and thereby that of gamma-tubulin to the centrosome in mitotic cells. PMID: 22818914
  11. The interaction between the human NimA-like protein kinase Nek9 and the Helicobacter HcpC has been validated by ELISA and surface plasmon resonance. PMID: 21735226
  12. Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5. PMID: 21642957
  13. DYNLL/LC8 protein controls signal transduction through the Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9. PMID: 21454704
  14. binds the Ran GTPase and regulates mitotic progression PMID: 12101123
  15. Activated in mitosis, and activates nek6 and nek7 kinase. PMID: 12840024
  16. mediates certain cellular processes, which are ultimately essential for interphase progression PMID: 14660563
  17. The disruption of a nuclear function of NEK9 by adenovirus E1A-associated cellular proteins is reported. PMID: 17443675
  18. The activity of Nek6 and Nek7, but not the tyrosine mutant, is increased by interaction with the Nek9 noncatalytic C-terminal domain, suggesting a mechanism in which the tyrosine is released from its autoinhibitory position. PMID: 19941817

Show More

Hide All

Involvement in disease
Lethal congenital contracture syndrome 10 (LCCS10); Nevus comedonicus (NC); Arthrogryposis, Perthes disease, and upward gaze palsy (APUG)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Protein kinase superfamily, NEK Ser/Thr protein kinase family, NIMA subfamily
Tissue Specificity
Most abundant in heart, liver, kidney and testis. Also expressed in smooth muscle cells and fibroblasts.
Database Links

HGNC: 18591

OMIM: 609798

KEGG: hsa:91754

STRING: 9606.ENSP00000238616

UniGene: Hs.624721

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*